KEGG   Pantoea ananatis AJ13355: PAJ_1694
Entry
PAJ_1694          CDS       T01969                                 

Gene name
phnL
Definition
(GenBank) phosphonates transport ATP-binding protein PhnL
  KO
K05780  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnL [EC:2.7.8.37]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00440  Phosphonate and phosphinate metabolism
paj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    PAJ_1694 (phnL)
Enzymes [BR:paj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     PAJ_1694 (phnL)
SSDB
Motif
Pfam: ABC_tran AAA_16 SMC_N RsgA_GTPase AAA_21 AAA_33 AAA_29 AAA_22 AAA_30 AAA_23 MMR_HSR1 NACHT DUF815 TsaE AAA_28 NB-ARC CPT AAA_25 cobW FtsK_SpoIIIE VirE Viral_helicase1 AAA_18 AAA RNA_helicase DAP3 AAA_15
Other DBs
NCBI-ProteinID: BAK11774
UniProt: A0A0H3KX59
Position
complement(2050457..2051176)
AA seq 239 aa
MATATMKTQLRVENLCKTFVLHNQNGAALPVLQDASLEVSEGECVVLHGHSGSGKSTLLR
ALYGNYQANSGSIWVQHLGEWVDMAQAPARQIIAIRRDTIGWVSQFLRVIPRVPTLEIVM
QPLLERGVERSFCEARAKDLLTRLNVPQRLWSLAPSTFSGGEQQRVNIARGFIADYPVLL
LDEPTASLDSVNSAAVVSLIEQARARGAAIVGIFHDEAVRERVADRLHVMQPFKTGAEA
NT seq 720 nt   +upstreamnt  +downstreamnt
atggcgacagcgactatgaagacgcaactgcgcgtggaaaatttgtgcaaaacctttgtg
ctgcacaatcagaacggggcggctctgccggtgctgcaggatgccagcctggaagtcagt
gagggcgaatgcgtggtgctgcacgggcattcgggcagcggaaaatcgactctgctccgt
gccctttatggcaactatcaggccaacagcggcagtatctgggtgcagcatctgggcgaa
tgggtcgatatggcacaggcacccgcccgccagattattgccattcgccgggataccatc
ggctgggtcagtcagtttctgcgggtcatcccgcgcgtgccgaccctggagatcgtcatg
cagccgttactggaacgcggcgtggaacgcagcttctgcgaagcgcgcgccaaagatctg
ctgacccggctcaacgtcccgcaacgcctctggtccctggcaccctcgacgttctccggt
ggagagcagcagcgcgtcaacatcgcccgtggctttattgccgattatcccgtgctgctg
ctggatgagcctacggcatcgctcgacagcgttaacagcgccgcagtcgtgagtctgatt
gaacaggcgcgcgcgcgtggcgcggccattgtcggtatttttcatgatgaagcggtgcgg
gagcgtgtggccgatcgcctgcacgtgatgcagcccttcaaaacaggggcagaagcatga

DBGET integrated database retrieval system