KEGG   Pantoea ananatis AJ13355: PAJ_1695
Entry
PAJ_1695          CDS       T01969                                 

Gene name
phnK
Definition
(GenBank) phosphonates transport ATP-binding protein PhnK
  KO
K05781  putative phosphonate transport system ATP-binding protein
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    PAJ_1695 (phnK)
SSDB
Motif
Pfam: ABC_tran AAA_21 oligo_HPY AAA_16 AAA_22 AAA_29 NACHT AAA_23 MobB AAA_33 AAA_25 RsgA_GTPase AAA_30 cobW AAA_5 Zeta_toxin AAA_18 PRK Pox_A32 AAA_28 MMR_HSR1 SbcCD_C AAA Propep_M14 DUF87 NB-ARC DUF2813 AAA_14 AAA_24 TsaE RNA_helicase Septin Roc
Other DBs
NCBI-ProteinID: BAK11775
UniProt: A0A0H3L1N4
Position
complement(2051176..2051937)
AA seq 253 aa
MHSEQPLLAVNNLTHLYAPGKGFEEVSFDLYPGEVLGIVGESGSGKTTLLRSLSARLAPQ
AGAIHYLQRDLYQMSESDRRRLLRTEWGVVHQHPLEGLRPQVTAGGNIGERLMAVGHRHY
GEIRAEASHWLQAVEIAANRIDDLPTTFSGGMQQRLQIARNLVTQPKLVFMDEPTGGLDV
SVQARLLDLLRTLVRELNLAVIIVTHDLGVARLLAHRLLVMKQGRVVESGLTDRVLDDPH
HPYTQLLVSSVLN
NT seq 762 nt   +upstreamnt  +downstreamnt
atgcacagtgaacaaccgctgctcgcggtcaataacctcacgcatctttacgcaccaggc
aaaggtttcgaagaggtcagctttgatctctacccgggcgaggtgctggggattgtgggt
gagtccggttcgggtaaaaccacgttgctgcgcagcctgtctgcccggctggccccgcag
gcaggcgcaattcattacctgcagcgcgatctttaccagatgagcgaaagcgaccgccgc
cgcttactgcgcacggagtggggcgtggtacaccagcatccgctggaaggactgcgtcct
caggtcacggcgggcggcaatatcggtgaacgtttaatggccgtcggccatcgtcactat
ggcgagatccgcgccgaggcgagtcactggctgcaggcggtggaaatcgcagcgaaccgt
atcgatgacctgccgacgacgttttccggcggcatgcaacagcgtctgcaaatcgcccgc
aatttagtgacccagccgaaactggtgtttatggatgaacccacaggcgggctggacgtc
tcggtgcaggcgcgactgctggacctgctgcgtacgctggtgcgcgaactgaatctggcg
gtgatcattgtgacccacgatctgggcgtggcgcgcctgctggcgcatcggctgctggtc
atgaagcagggccgggtcgtggaaagtggtttaacggaccgcgtgctggatgatccgcat
catccttatacgcaactgctggtttcatcggtgcttaactaa

DBGET integrated database retrieval system