KEGG   Pantoea ananatis AJ13355: PAJ_1696
Entry
PAJ_1696          CDS       T01969                                 

Gene name
phnJ
Definition
(GenBank) protein PhnJ
  KO
K06163  alpha-D-ribose 1-methylphosphonate 5-phosphate C-P lyase [EC:4.7.1.1]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00440  Phosphonate and phosphinate metabolism
paj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    PAJ_1696 (phnJ)
Enzymes [BR:paj01000]
 4. Lyases
  4.7  carbon-phosphorus lyases
   4.7.1  carbon-phosphorus lyases (only sub-subclass identified to date)
    4.7.1.1  alpha-D-ribose 1-methylphosphonate 5-phosphate C-P-lyase
     PAJ_1696 (phnJ)
SSDB
Motif
Pfam: PhnJ YjdM_Zn_Ribbon
Other DBs
NCBI-ProteinID: BAK11776
UniProt: A0A0H3KXJ3
Position
complement(2051927..2052775)
AA seq 282 aa
MAELSGYNNGYLDEQTKRTIRRAILKAVAIPGYQVPFAGREMPMPYGWGTGGIQITASVI
GDKDVLKVIDQGADDTTNAVSIRRFFQRVSGAATTERTVDATLIQTRHRIPETPLEEDQI
LIFQVPIPEPLRFIEPREKETRTMHALEEYGIMQVKLYEDIARFGHIATTYAYPVKVNDR
YVMDPSPIPKFDNPKMHMMPALQLFGAGREKRIYALPPYTKVESLDFDDHPFTVQQWDEP
CALCGSRHSYLDEVVMDDQGTRMFVCSDTDFCHQQQEQQHAQ
NT seq 849 nt   +upstreamnt  +downstreamnt
atggctgaactcagcggctataacaacggctaccttgacgagcaaaccaaacgcacgatc
cggcgcgccatcttaaaagcggtggcgattcccggctatcaggtgccctttgccggacgc
gaaatgccgatgccttacggctggggcaccggcgggattcaaatcaccgccagcgtcatt
ggcgacaaagacgttctgaaagtcatcgaccagggcgcggacgatacgaccaacgccgtc
tccatccgtcgtttcttccagcgagtgagcggcgcggccaccacggaacgcacggtggat
gccacgctgattcagacgcgtcaccgtattccggaaaccccgctggaagaagatcagatc
ctgatttttcaggtgccgattcccgagccgctgcgctttattgagccgcgcgagaaggaa
acccgcaccatgcatgcgctggaagagtacggcatcatgcaggtcaaactgtacgaagat
atcgcccgtttcggccacatcgccaccacctatgcctatccggtgaaggtcaacgatcgc
tatgtgatggatccgtcgccgattcccaaattcgataacccgaagatgcacatgatgccc
gccctgcagctgtttggtgccggacgcgagaagcgcatctatgccttgccgccttacacc
aaagttgaaagcctcgacttcgacgatcatcccttcaccgtgcagcagtgggacgaaccc
tgtgcgctgtgcggatcgcgtcacagctatctggacgaggtagtgatggacgatcaggga
acgcgcatgtttgtgtgctcagataccgatttttgccaccagcagcaggaacaacaacat
gcacagtga

DBGET integrated database retrieval system