KEGG   Pantoea ananatis AJ13355: PAJ_1697
Entry
PAJ_1697          CDS       T01969                                 

Definition
(GenBank) carbon-phosphorus lyase complex subunit
Organism
paj  Pantoea ananatis AJ13355
SSDB
Other DBs
NCBI-ProteinID: BAK11777
UniProt: A0A0H3L4L7
Position
2052086..2052703
AA seq 205 aa
MIVEVEAFNFGVRRQGIDALLASGTKQLQGGHHVHLRVIEFGNRRRIHHIAIVDLHRIGI
GGGDVAETGDIFVQFDLHDAVLFQRMHGAGFLLARLNKAQRLGNRHLKNQDLIFFQRGFR
NTVTRLNQRGIHRAFRGGRAAHSLEETTDGDGVGRIVRALVDDFQNVFVANDAGGDLNPA
GAPAVRHRHFASGKGHLIAGNRHRF
NT seq 618 nt   +upstreamnt  +downstreamnt
atgatcgtcgaagtcgaggctttcaactttggtgtaaggcggcaaggcatagatgcgctt
ctcgcgtccggcaccaaacagctgcagggcgggcatcatgtgcatcttcgggttatcgaa
tttgggaatcggcgacggatccatcacatagcgatcgttgaccttcaccggataggcata
ggtggtggcgatgtggccgaaacgggcgatatcttcgtacagtttgacctgcatgatgcc
gtactcttccagcgcatgcatggtgcgggtttccttctcgcgcggctcaataaagcgcag
cggctcgggaatcggcacctgaaaaatcaggatctgatcttcttccagcggggtttccgg
aatacggtgacgcgtctgaatcagcgtggcatccaccgtgcgttccgtggtggccgcgcc
gctcactcgctggaagaaacgacggatggagacggcgttggtcgtatcgtccgcgccctg
gtcgatgactttcagaacgtctttgtcgccaatgacgctggcggtgatttgaatcccgcc
ggtgccccagccgtaaggcatcggcatttcgcgtccggcaaagggcacctgatagccggg
aatcgccaccgcttttaa

DBGET integrated database retrieval system