KEGG   Pantoea ananatis AJ13355: PAJ_1698
Entry
PAJ_1698          CDS       T01969                                 

Gene name
phnI
Definition
(GenBank) protein PhnI
  KO
K06164  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnI [EC:2.7.8.37]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00440  Phosphonate and phosphinate metabolism
paj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    PAJ_1698 (phnI)
Enzymes [BR:paj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     PAJ_1698 (phnI)
SSDB
Motif
Pfam: PhnI
Other DBs
NCBI-ProteinID: BAK11778
UniProt: A0A0H3KXG5
Position
complement(2053118..2053843)
AA seq 241 aa
MYVAVKGGEKAIANAHHLQADLRRGDRAVAELSCDQIAQQLGLAVDRVMTEGGIYDPALA
ALAIKQASGDLVEAIFLLRAYRTTLPRLAQSTPLDTGNMRIERRISAVYKDLPGGQVLGP
TYDYSHRLLDFTLMANGETPLPPRSEQALPEHCPHMFSMMSDEGLAERESDDGSEPTDIT
REPMGFPASRAARLQQLVRGDEGFLLSLGFPPARLWPHPSVCRRNPDRLCQRQRLPGRTG
I
NT seq 726 nt   +upstreamnt  +downstreamnt
atgtacgtagcggttaaagggggcgaaaaagccattgccaatgcccatcatcttcaggcc
gatcttcgtcggggcgaccgtgcggtcgcggagttatcctgcgatcagatcgcgcagcag
cttggcctggcggtagatcgtgtgatgaccgaaggcggcatttacgatcccgcgctggcg
gcgttagccattaaacaggccagcggcgatctggttgaggccatttttttactgcgcgcc
tatcgcacaaccctgcctcgcctggcgcaaagcacgccgctggacaccggcaacatgcgg
atcgagcggcgtatctccgcggtttataaggatttgcctggcggtcaggttttaggccca
acctatgactacagccaccggctgctggactttaccctgatggctaacggggaaacgcct
ctgccgccgcgcagcgagcaggcgctgcccgaacactgcccgcacatgttcagcatgatg
agcgacgaaggcttagcagagcgtgaaagcgacgacggcagcgaacccaccgacatcacc
cgagagccgatgggctttcccgcctcacgtgccgcacgactgcaacagctggtgcgcggc
gatgaaggttttctgctgtcgctgggctttcccccagcgcggctatggccgcacccatcc
gtttgccggagaaatccggaccggttatgtcagcgtcagcgtttgcccggaagaactggg
atttga

DBGET integrated database retrieval system