KEGG   Pantoea ananatis AJ13355: PAJ_1700
Entry
PAJ_1700          CDS       T01969                                 

Gene name
phnG
Definition
(GenBank) protein PhnG
  KO
K06166  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG [EC:2.7.8.37]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00440  Phosphonate and phosphinate metabolism
paj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    PAJ_1700 (phnG)
Enzymes [BR:paj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     PAJ_1700 (phnG)
SSDB
Motif
Pfam: PhnG
Other DBs
NCBI-ProteinID: BAK11780
UniProt: A0A0H3L1P0
Position
complement(2054415..2054864)
AA seq 149 aa
MKQQTARQHWLSVLAHSSAAELDAYWQPLNLKPEFTLIRPAEIGLTRLQARMGATGKRFV
VGDATVTRAVVRLNDGTLGYSYLLGRDKAHAERCALMDALLQQADTAELLQEKMIIPLAA
SREEQRQLRAREIASSKVDFFTLVRGDNE
NT seq 450 nt   +upstreamnt  +downstreamnt
atgaaacagcaaacggcccgccagcactggctttcggtgttggcacacagcagcgcagcc
gagcttgacgcgtactggcagccgctcaacctcaagcccgaatttaccctgattcgcccg
gccgagattggcctgacgcgtctgcaggcccgcatgggcgccaccggcaaacgctttgtg
gtgggcgatgccaccgtgacgcgtgcggtggtgcggctgaacgacggcaccctgggttac
agctatctgctcggccgggataaagcccatgccgaacgctgtgccctgatggatgccctg
ttgcaacaggccgacaccgctgaactgctgcaggaaaaaatgattatcccgctggcggcc
tcacgtgaagagcagcgtcagctgcgcgcacgtgaaatcgccagcagcaaagtggacttc
tttacgctggtacgcggagacaatgaatga

DBGET integrated database retrieval system