KEGG   Pantoea ananatis AJ13355: PAJ_1701
Entry
PAJ_1701          CDS       T01969                                 

Gene name
phnF
Definition
(GenBank) probable transcriptional regulator PhnF
  KO
K02043  GntR family transcriptional regulator, phosphonate transport system regulatory protein
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:paj03000]
    PAJ_1701 (phnF)
Transcription factors [BR:paj03000]
 Prokaryotic type
  Helix-turn-helix
   GntR family
    PAJ_1701 (phnF)
SSDB
Motif
Pfam: GntR UTRA HTH_Crp_2 HTH_DeoR MarR_2 MarR Rrf2 HTH_23 HTH_36 HTH_11 RP-C
Other DBs
NCBI-ProteinID: BAK11781
UniProt: A0A0H3KXJ9
Position
complement(2055099..2055578)
AA seq 159 aa
MELSRHPTTVYQAVAAQLEQAVQERYRSGDYLPSEQQLADHYAVNRHTLRRAVDELVNKG
LLQRRHGVGILVLMRPYDYPLHAQARFSQNLMEQGSDPTSERLLAVLRPASADVAAALGV
SEGDNVIHLRTLRRVNGLPVCLINHFLCRSQLVATAAAL
NT seq 480 nt   +upstreamnt  +downstreamnt
atggagttatccagacatccgaccactgtctatcaggctgttgccgcgcaactggagcag
gctgttcaggaacgttaccgcagcggtgactatttaccctctgagcagcagctggccgat
cactatgcggtgaaccgccacacgctgcgtcgggcggtagacgaactggtgaacaagggc
ctgctgcagcgtcgccatggcgtcggcattttagtgctgatgcgcccctacgactatccg
ttacacgctcaggctcgcttcagccagaacctgatggagcagggcagcgatcccaccagt
gaacgtctgctggcggtgctgcgcccggccagtgccgacgtggccgccgcgcttggcgtc
agtgaaggcgataacgttattcacctgcgaaccctgcgccgtgtaaatggcctgccggtc
tgcctgatcaaccacttcctttgccgatctcagctggtggccacagctgcagcgctttaa

DBGET integrated database retrieval system