KEGG   Pantoea ananatis AJ13355: PAJ_1702
Entry
PAJ_1702          CDS       T01969                                 

Gene name
ycdL
Definition
(GenBank) isochorismatase family protein YcdL
  KO
K23359  biuret amidohydrolase [EC:3.5.1.84]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00791  Atrazine degradation
paj01100  Metabolic pathways
paj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    PAJ_1702 (ycdL)
Enzymes [BR:paj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.84  biuret amidohydrolase
     PAJ_1702 (ycdL)
SSDB
Motif
Pfam: Isochorismatase
Other DBs
NCBI-ProteinID: BAK11782
UniProt: A0A0H3L4M2
Position
complement(2055743..2056432)
AA seq 229 aa
MPEYSVNSTPYAWPFDGHFSPADTALLVIDMQTDFCGPGGYVDRMGYDIGLTRAPVEPLK
VLLARMRALQFPIIHTREGHRADLSDLPANKRWRSARMQAEIGSAGPCGRILVRGEPGWE
IIPELAPLAGEVIIDKPGKGSFYATDLELVLRSRGIRNLIITGITTDVCVHTTLREANDR
GYECLVLSDCCAATEQRHHEAALSMIHMQGGIFGAVATSAALLDTLGQP
NT seq 690 nt   +upstreamnt  +downstreamnt
atgcctgagtacagtgtgaattccaccccttatgcctggccgtttgatggccattttagt
ccggccgacacggctctcctcgtcattgatatgcaaaccgatttttgcggcccggggggg
tacgttgacaggatgggctacgacattggcctgacgcgtgcgcctgtcgaaccccttaaa
gtgttactggcacgtatgcgggcgcttcagtttcccatcattcacacccgggaagggcat
cgcgcggacctgagtgacttaccggcaaacaagcgctggcgttcggccaggatgcaggcg
gagatcggcagtgcagggccgtgcggccgtatcctggtgcgcggtgagccgggctgggag
attatccccgagctcgcccccttagcaggagaagtgatcattgataagcccggtaaagga
tccttttatgccacagaccttgagctggtcttacgcagtcgcggcattcggaatttaatt
attaccggtatcacgacggatgtatgtgttcatacgacgctgagagaggccaacgatcgc
ggatatgagtgcctggttttgtccgactgttgtgccgccacagagcaacgccatcatgaa
gccgcgctgagcatgatccacatgcagggcggcatctttggtgccgttgccacctctgcc
gcgctgctggacacgctcggtcagccttaa

DBGET integrated database retrieval system