KEGG   Pantoea ananatis AJ13355: PAJ_1703
Entry
PAJ_1703          CDS       T01969                                 

Gene name
codB
Definition
(GenBank) cytosine permease CodB
  KO
K10974  cytosine permease
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paj02000]
    PAJ_1703 (codB)
Transporters [BR:paj02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   PAJ_1703 (codB)
SSDB
Motif
Pfam: Transp_cyt_pur
Other DBs
NCBI-ProteinID: BAK11783
UniProt: A0A0H3KXH1
Position
complement(2056425..2057729)
AA seq 434 aa
MKKQASPTLEQEFEHEPVPLSHRHPTRSVSAVWFGFPMILTNALFGGIITWHLGFWPALL
AIVMGNLVLFAYVGALSWFAGNTGMNFALQAKRTFGSKGYILVSGFLSTVVIGWYAFQTG
LTGTVIHETFGWNALSVTAFAMVLFTAVTFLGVRALSVLGMIAAPMFVILGFVALYFVGQ
THEFSSMFHWKGSPAVAGAMSMGTAVTMVVAGFADSGTMTADFTRWSKSGRAAVIAAFSA
FPVANLIAYLFGVIIVSVGAAVDPLTNGGNFLPMLMGHGDVLTLVAFLFVFINLGSVCTH
CLYNGAVGFSHLFNSKMRRWTLILGAIGGLLALAGVWSYFLEWLSLLGVVVPPFGAVMIV
DLIFMAKLSEQRPAQRFHGAAFAAWALGSLCAVVAHLAFPQFGEAVIGLVTAALSYTLII
KLRSPTPRLEKNNA
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgaaaaaacaggcttccccaacgttagaacaggagtttgagcacgaacccgtgccgctc
tcacatcgccatccgacccggtcggtttcggccgtctggtttggttttcctatgatcctc
acgaatgcgctgtttggcggcatcatcacctggcaccttggcttctggcctgcgctgctg
gcgattgtgatgggcaatctggtgctgtttgcctacgtcggtgcgctgagctggtttgcc
ggtaataccggtatgaactttgccctgcaggcgaaaagaacctttggcagcaaaggttac
atcctcgtgtcgggcttcctctcgaccgtggtgattggctggtacgcctttcagaccgga
ctgaccggcacggtgattcatgagaccttcggctggaatgccctgtcggtgacggcattt
gccatggtgctgtttacggccgtgaccttcctgggcgtgcgcgccttgtcggtgttgggc
atgattgctgcgccgatgtttgtgattctggggtttgtcgcgctgtacttcgtggggcag
acgcatgaattttccagcatgtttcactggaaaggcagcccggcggtggcgggggccatg
agcatgggcacggcggtcaccatggtggtggcgggttttgccgattccggcaccatgacc
gccgatttcacccgctggtcgaagagtggacgtgctgcggtcattgccgccttttcggcc
tttccggtcgcgaatttgatcgcctatctgtttggcgtgattatcgtctcggttggcgcg
gcggtcgatccgctgaccaacggcggcaactttctgcccatgctgatgggccatggtgat
gtcctgaccctggtggctttcctgtttgtgtttatcaaccttggctcggtatgtacgcac
tgtctttataacggtgcagtcgggtttagccatctctttaacagcaagatgcgccgctgg
accctgattcttggcgccatcggcggtctgctggcactggcaggcgtctggtcatatttt
ctcgagtggctgagtctgctgggcgtggtggtgccgccgtttggtgcggtcatgattgtt
gatctgatttttatggcaaagctgagtgaacagcgcccggcgcaacgcttccatggcgcg
gctttcgcggcctgggcgctgggaagcctgtgcgcggtcgtcgcgcatctggcgttcccc
cagtttggcgaagcggtcatcggtctggtgacggccgcactcagctacaccctgattatt
aaattacgttcccccacgccgcgactggagaagaacaatgcctga

DBGET integrated database retrieval system