KEGG   Pantoea ananatis AJ13355: PAJ_1704
Entry
PAJ_1704          CDS       T01969                                 

Definition
(GenBank) serine protease
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: PAP2 PATR
Other DBs
NCBI-ProteinID: BAK11784
UniProt: A0A0H3KX68
Position
2058222..2060147
AA seq 641 aa
MSAAVRFGIYLALFSGMVSTPVLGHDRSATARPVPPRDPGFTDSAPAADVPAFIDNIATN
QRGDARFATLDTNAGVRVVSGFLALWRPRTLKVDAGVTAPAREGFAAITPSDCTGLPDKA
PVCGTILNSHVLAANVQYVVTTTRRRTAAQAEAAYYDDRRGKGYSVTDGMGPLTGAWRSA
AQQVTTLTRIPADATTVLYVDKGNNTGVGSQEGNRDFGLVVDFLNEMGNNASTEPVKRFY
KYARPYRWRSAVEVVPALVPAENPQPATDGGFISGHTAEAVRDALTMAWLVPERYQEMVS
RGMELGENRIVAGMHSPLDVIGGRMLALAVTTANLTAYHEDARRAFTQAHQALWQRTATQ
PATFFAYAHAAPPSADRFADPTLNRLQALRRMTFGFAPIGPRHRSPVVPKGAEILLETRF
PYLSALQRRVVLKTTALASGYPIMDDAEGWGRLNIVAAADGYGQFTGNVKVAMDAAKGGF
NQSDSWRNAIGGQGKLTLQGSGTLRLTGANRYSGGTEVQGGVLEAGSARAFGVGDLYVGN
QGRVRIAALSPVQVKSYTALPEASLELDIDGQGGGRLIVNGPLVAGGTLLVKFVKGYRPE
AGDLIPLMQAGSLAAHFSRIIVEGYQARPVSSATRLGIKLL
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgtctgctgctgttcgttttggcatttatctggcgctgttttctggcatggtttcgacg
cctgttttgggtcatgatcggtccgctaccgcacggcctgtcccgccgagggatccgggc
ttcaccgacagcgcgcctgcggcagacgtgcccgcttttatcgacaatatcgccacgaac
caacgtggtgatgcccggtttgcgacgctcgacaccaatgccggcgtgcgcgtggtatcc
ggctttcttgccctgtggcgcccacgcacgctgaaggtcgatgcgggagttaccgcgccg
gcccgtgagggttttgcagccattacgccttctgactgtacgggactgcctgacaaagcc
cccgtatgcggcacaatccttaattctcatgtcttggccgcgaatgttcagtatgtggtg
acaacgacacgacgccgcacggcagcccaggctgaggcggcctattacgacgaccgtcgt
ggcaaaggctacagcgtcacagatggcatggggccactgacgggcgcatggcgcagtgcg
gcccagcaggtcacaaccctgacacgcattccggctgatgccaccactgtgctgtacgtg
gataaaggcaacaataccggcgtgggcagtcaggaaggcaatcgcgacttcggtctggtg
gtggattttctcaatgaaatgggcaacaacgcctcgaccgaaccggtgaagcgcttctat
aaatatgcgcgtccgtatcgctggcgttcggcggtggaggttgttcctgcccttgtgcct
gcggagaatccacagcccgccaccgacggcggatttatcagcggccacacggcggaagcc
gtcagagatgcccttaccatggcgtggctggtgccggagcgctatcaggagatggtcagc
cgcggtatggagctgggcgaaaaccggatcgtggccggaatgcactcgcctctggacgtc
atcggcgggcgcatgctggcgctggcggtgaccaccgcaaatctgacggcttatcatgag
gatgccaggcgtgccttcacccaggcgcatcaggcattatggcaacgcaccgcgacgcaa
ccggccaccttctttgcctatgcccatgccgcgccgccgagcgccgatcgcttcgccgat
cccacccttaaccgccttcaggcgctgcggcgcatgacctttggtttcgcccccatcggc
cctcgccaccgttcccccgtggtgcccaaaggggccgagattttgctggaaacccggttt
ccctatctgagcgccctgcaacggcgcgtggtattaaaaactaccgcattggcctcaggc
tacccgatcatggacgatgctgagggctggggacgcctgaacattgtggccgccgccgac
ggatatggtcagtttaccggcaacgttaaagtagcaatggacgccgctaaaggcggtttt
aatcagtccgacagctggcggaatgcgatcggcggtcagggaaagctgaccttacagggt
tcaggcaccctgaggctgactggcgcgaaccgctacagcggcggtacggaggttcagggt
ggcgtgctggaagccggttcagcccgcgcctttggcgtgggtgatctctatgtgggcaat
cagggccgcgtgcgcattgctgccctgtcgccggtacaggtgaaaagctacacggcgctg
cccgaagccagtcttgaactggatattgatggtcagggcggtggccgtctcatcgtgaac
gggcctttagtggcgggggggacgctgctggtgaagtttgtcaaaggctatcgtcccgaa
gcgggcgatctgatcccgttgatgcaggcaggctcacttgcggcgcactttagtcgcatc
attgtcgaaggctatcaggctcgacctgtcagcagcgcgacacgactaggtattaagctg
ctctga

DBGET integrated database retrieval system