KEGG   Pantoea ananatis AJ13355: PAJ_1705
Entry
PAJ_1705          CDS       T01969                                 

Gene name
lrp
Definition
(GenBank) leucine-responsive regulatory protein Lrp
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: HTH_24 AsnC_trans_reg HTH_AsnC-type MarR MarR_2 HTH_20 PgaPase_1 HTH_CodY Rrf2 HTH_Crp_2
Other DBs
NCBI-ProteinID: BAK11785
UniProt: A0A0H3L1P5
Position
complement(2060217..2060741)
AA seq 174 aa
MRGAMNGLMKLDRIDINILVQLQKDGRISNVNLADAVGLSPSPCLQRVKRLEQAGFITGY
EAHVNLTKITDSVTVFTEVTLNGHRREDFMKFEAAMREVDELMECHLITGGYDYLLRFIT
RSIEHYQDVIEKMLDAQIGIDKYFSYIVIKSPVMKSSVPLRSLISKHNPMEFGV
NT seq 525 nt   +upstreamnt  +downstreamnt
atgaggggtgctatgaacggcttaatgaaactcgaccgcatcgatatcaatattctggtg
caactccaaaaagatggccgtatcagcaacgtcaatctcgccgatgcagtggggctgtcc
ccgagtccctgcctgcagcgggtaaaacggctggagcaggccggctttattaccggctac
gaagcgcacgttaatctcaccaaaattaccgattccgtcaccgtgtttaccgaagtcacc
ctgaacggacatcgtcgcgaagactttatgaagttcgaagctgcgatgcgtgaagttgat
gaactgatggagtgccacttgattaccggtggctacgattacctgttgcgctttattacc
cgcagcattgagcattatcaggatgtgattgagaagatgctggatgcgcaaattggtatc
gataagtacttcagctatatcgtgattaaatcacccgtcatgaaaagcagcgtgccgctg
cgctcactgattagcaagcataacccgatggagttcggcgtctga

DBGET integrated database retrieval system