KEGG   Pantoea ananatis AJ13355: PAJ_1708
Entry
PAJ_1708          CDS       T01969                                 

Gene name
ycdW
Definition
(GenBank) putative 2-hydroxyacid dehydrogenase YcdW
  KO
K12972  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00260  Glycine, serine and threonine metabolism
paj00620  Pyruvate metabolism
paj00630  Glyoxylate and dicarboxylate metabolism
paj01100  Metabolic pathways
paj01110  Biosynthesis of secondary metabolites
paj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PAJ_1708 (ycdW)
   00630 Glyoxylate and dicarboxylate metabolism
    PAJ_1708 (ycdW)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAJ_1708 (ycdW)
Enzymes [BR:paj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     PAJ_1708 (ycdW)
    1.1.1.81  hydroxypyruvate reductase
     PAJ_1708 (ycdW)
SSDB
Motif
Pfam: 2-Hacid_dh_C NAD_binding_2 2-Hacid_dh
Other DBs
NCBI-ProteinID: BAK11788
UniProt: A0A0H3KXH6
Position
complement(2063546..2064472)
AA seq 308 aa
MHVVYKSEPQRGLYWQRWLAEHAPDIHLHLWPETGDAAQVDALVAWLPPDDLMACFPNLK
VLFSVGAGAEQFDLSTLPGHIPLVRTIEPGLTQGMVEYVTFAVLGLHRDMPRYFQQQRHQ
QWQAHLAMPASQRRIGIMGLGELGRAALAQLQSMGFDCGGWSRTPHHIAGVPCWHGDDQL
SDFLARSDILVCLLPLTSSTQGRLNAGLFGQLPAGAALVQVGRGPQLNHQDLLDALDSGQ
LRAAVIDVTDPEPLPAGHAFWTHPAVWLTPHIASQTQNDSAIKALLANLRRFQRGEPLVG
VVDRSRGY
NT seq 927 nt   +upstreamnt  +downstreamnt
atgcacgttgtctataaatctgaaccccagcgcggcctctactggcagcgttggctggct
gaacacgcgcccgatatccacttacatctctggccggaaaccggtgatgcggctcaggtt
gatgccctggtcgcctggttgccgccggatgaccttatggcctgttttcccaatctgaaa
gtcctgttttctgtgggcgcaggggctgagcagtttgatctgtccacgctgcctggccac
atcccgctggtcagaacgattgaacctggcctgacgcagggcatggtggaatacgtcacc
tttgcggtgctggggctgcatcgcgacatgccacgctatttccagcagcaacgccaccag
cagtggcaggcgcatctggcgatgcccgccagtcagcgtcgcatcggcattatgggcctg
ggcgaactgggccgcgcggcgctggcgcagcttcagtcgatgggatttgactgcggcggc
tggagccgtacgccgcaccatattgcgggcgtgccgtgctggcatggtgacgatcagctg
tccgactttctggcgcgcagcgatattctggtgtgcctgctgccgctaacgtccagcacc
cagggacgcctgaatgccgggctgttcggccagttgcctgcgggagccgcactggttcag
gtgggacgcggccctcagctaaatcatcaggacctgttggatgcgctcgacagcggccag
ttacgggccgcggtgatcgatgtcaccgatcccgaacctttgcctgccggtcacgcattt
tggacgcacccggctgtgtggttgacgccgcacatcgccagccagacgcagaatgacagc
gcgattaaggcgcttctggctaacctgcgtcgctttcagcgcggcgagccgctggtcggc
gtcgttgatcgttcacgaggatattga

DBGET integrated database retrieval system