KEGG   Pantoea ananatis AJ13355: PAJ_1709
Entry
PAJ_1709          CDS       T01969                                 

Definition
(GenBank) acetyltransferase GNAT Family
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: Acetyltransf_18 Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 FR47 Acetyltransf_9 Acetyltransf_3 GNAT_acetyltran Acetyltransf_CG
Other DBs
NCBI-ProteinID: BAK11789
UniProt: A0A0H3KX73
Position
complement(2064472..2065314)
AA seq 280 aa
MTFDIRSMTTEDIPQVYAMSQALNWPHRHEDWAIGIELGEGVVIEDQGEVIGSAILWRWG
DKAATIGLVIVANSHQGRGLGKQLMLALLEKVPGYNVRLHATEMGKGLYEKLGFVACGKI
LQYQTPSLTTLPRVAIPAGLTLRSATLDDRDALVNMDQAAHGLFRPSLVAHLITDNQTVI
LQDDEQRLKGFASLRRFGRGWVIGPVIAEDFPVAQALTAALMQGMKGEYLRMDTDAALPL
APWLESLGLTNVDAPVTMVRGEVWVAQGMQAFGLTTQAMA
NT seq 843 nt   +upstreamnt  +downstreamnt
atgacatttgatattcgtagcatgacgaccgaagacattccgcaggtttatgcgatgagc
caggcgctaaactggccgcaccgccatgaagactgggcgatcggcattgagcttggcgaa
ggcgtggtgattgaagatcagggtgaagtgattggcagcgcgattctctggcgctggggc
gacaaagccgccaccatcggtctggtcattgtcgcaaactcacatcaggggcgcgggctg
ggcaagcagctgatgctggccttgttagagaaagttcccggctacaatgtgcgtctgcac
gccaccgagatggggaaaggcctgtatgaaaagctcggcttcgttgcctgcggtaagatc
cttcagtaccagacgccatccctgacgacgctgcccagggtcgcgatcccggctgggttg
acgttgcgcagcgccacccttgacgaccgggatgcgctggtaaacatggaccaggccgcc
cacgggcttttccgcccgtcgctggtggcgcatctgattaccgacaatcagaccgtgata
ttgcaggatgatgagcaacgccttaagggctttgccagcctgcgccgctttggccgtggc
tgggtcattggccccgttattgcagaagattttccggttgcgcaggccctgacggctgcg
ctgatgcagggcatgaagggcgagtatttgcgcatggatacggatgcggctttaccgctg
gctccctggctggagagcctgggcctcacgaatgttgatgcgcccgtcacgatggtgcgc
ggtgaggtctgggtagcgcaagggatgcaggcgtttggtctgaccacgcaggccatggcc
tga

DBGET integrated database retrieval system