KEGG   Pantoea ananatis AJ13355: PAJ_1710
Entry
PAJ_1710          CDS       T01969                                 

Gene name
sardH
Definition
(GenBank) sarcosine dehydrogenase, mitochondrial precursor SardH
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: DAO FAD_binding_2 GIDA NAD_binding_8 Thi4 Pyr_redox_2 FAD_oxidored FAD_binding_3 Pyr_redox_3 Lycopene_cycl AlaDh_PNT_C HI0933_like ApbA 3HCDH_N Trp_halogenase
Other DBs
NCBI-ProteinID: BAK11790
UniProt: A0A0H3L1Q1
Position
complement(2065325..2066656)
AA seq 443 aa
MPAPIRYVQDSPDFPDAADVVVIGAGIAGAAATWYLAKQGLKVVLIEKGLVGAEQSSRNW
GWCRQQNRDERELPLVIEALRGWEELSVETGEELGFRRSGLVYATRSEADIAAWDTWGQM
AKQYGVRSDILNAQQAKALTPGSTTNWLGGVSAPTDGAAEPRLAVPGIVIGAQKKGALVF
QQCAVRGLDISAGRVSGVITERGVVKAPRVICAAGAWTSMFCRRHGIDLPLGNVIGTAFR
TQPIDQAIAVPFYTESFACRPQLDGSYTVSVSGRGRLEPGAQGLRYLRQFYPTFKSRRKN
LTLNLGVKPFFHGPEALGRWDLDAVSPFERMRILDPAADAWVVESGLAAMRREFPALANL
KVAQAWGGMIDSTPDAIPVISTVAKLPGLVLSAGFSAHGFGIGPGAGRLAAELATDATPV
VDPTPYRYSRFIDGSELDAPGMM
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgcctgcaccgattcgttatgtacaggacagcccggacttcccggatgccgctgatgtg
gtggtgattggtgccggtatcgccggtgccgctgccacctggtatctggcaaagcagggc
ctgaaggtggtgctgattgagaagggcctggtcggggctgaacaatccagtcgcaactgg
ggctggtgccgtcagcagaatcgcgatgaacgtgaactgccgctggtgattgaagcctta
cgaggctgggaagaactcagtgtggaaaccggtgaagagctgggttttcgccgcagcgga
ctggtttacgccacccgcagtgaagcggacatcgccgcctgggatacatggggccagatg
gccaaacagtacggcgtacgcagcgacatattaaatgcgcagcaggcgaaagccctgacg
ccgggcagcactacaaactggctgggcggcgtttcggcccccaccgacggtgcagcagag
cccagactggccgtgccgggtatagtgattggcgcacagaaaaaaggggcgctggtgttt
cagcaatgtgcggtgcgcgggctggatatttcagcaggacgcgtcagcggcgtgataacc
gaacggggagtcgtcaaagccccccgcgtgatctgcgcagcgggtgcatggacgtcgatg
ttttgccgtcggcacggcatcgatctgccgctggggaatgtgattggcaccgcctttcgg
actcagcccatcgatcaggccattgccgttcctttttataccgaaagcttcgcctgtcgg
ccgcagctggatggcagctataccgtttccgtatcgggccgtggacggctggagcccggt
gctcagggcttgcgatatctgcgtcagttttatcccacgttcaaaagccgccgtaaaaat
cttaccctgaatctgggggtgaagccgttttttcacgggcctgaggcgttggggcgctgg
gatctggatgccgtttcgcctttcgaacggatgcgtattctggatccggctgccgatgcc
tgggtcgtggaaagcggactggccgcaatgcgccgcgaatttcctgccctggcgaatctc
aaagtcgcccaggcctgggggggaatgattgacagtacgccggatgccattccggttatt
tcaacggtggcaaaactgcctggcctggtgctgtcggcggggttcagcgcacacggtttt
ggtattggccccggcgcgggccgcctcgccgctgaactggcgacggacgcgacgccggtg
gtggatcccaccccttatcgttacagccgttttattgacggcagcgaacttgatgcacct
ggcatgatgtaa

DBGET integrated database retrieval system