KEGG   Pantoea ananatis AJ13355: PAJ_1711
Entry
PAJ_1711          CDS       T01969                                 

Gene name
yliA
Definition
(GenBank) hypothetical ABC transporter ATP-binding protein YliA
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:paj00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PAJ_1711 (yliA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paj02000]
    PAJ_1711 (yliA)
Transporters [BR:paj02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    PAJ_1711 (yliA)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA AAA_16 AAA_25 AAA_22 RsgA_GTPase AAA_5 ATP-synt_ab AAA_18 NACHT IstB_IS21 AAA_23 AAA_33 AAA_24 TsaE Roc PhoH APS_kinase AAA_7 AAA_15 PRK CbiA Sigma54_activat PduV-EutP Mg_chelatase oligo_HPY NB-ARC TIP49 MMR_HSR1 KdpD
Other DBs
NCBI-ProteinID: BAK11791
UniProt: A0A0H3KXL1
Position
complement(2066746..2068410)
AA seq 554 aa
MNVTQHTAMPVISVDNLRVTAHNDNGDELDIVSDIRFTVQKGEVLALIGESGSGKTTIAM
ALMGYARHGCKIAEGNIHVAGTNIMNLTPAQLRVFRGNKVAYIAQSAAASFNPGMKIIDQ
VIEPVVIHGTMTRKAAKAKALALFRELALPNPDTIGDRFPHQVSGGQLQRLMTAMALISD
PDVVILDEPTTALDVTTQVEVLKAFRRVVKQRGVTAIYVSHDLAVVAQMADRILVLLQGK
IAEYGTTAHLIGAPQADYTRLLMDAAQQKERPSHWCPAKAGELPLLEVRDLSAGYGPKGS
DGLPKVRILENINLTLWKGQAIGIIGESGSGKTTLAHAIAGLNPACQGQILFNGYTVADQ
MQKRTDNELRRIQYVFQMADTALNPAHSVERILSRPLTLFHGLSGIARQNRLYQLLDLVK
LPRTVLSRRPWSLSGGQKQRVNLARALAAEPDVILCDEVTSALDTVVASAVLDLISELRR
ELGLSVMFISHDMHAVRAVCDEIVVMRNGAIVTQLARGNYDQPTSELYFERLKRAVPELR
QGWLDEHEEILKAE
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgaacgtgacgcaacatacggcaatgcctgtgatatctgtcgataacctgcgcgtaacg
gcgcataacgacaacggggatgagctggatatcgtgtccgatattcgcttcacggtgcaa
aaaggcgaagtgctggcgctgattggcgaatccggctcgggtaaaaccactattgcgatg
gcgctcatgggctatgcacgccacggctgtaaaatagccgagggcaatattcatgttgcg
gggaccaacatcatgaatcttacccccgcacagttgcgcgtttttcgcggcaacaaagtc
gcctacattgcccaaagtgcggctgcctcttttaaccccggcatgaaaattatcgatcag
gtcattgaaccggtcgtgattcacggcaccatgacgcgcaaggcggcgaaggccaaagcg
ctggcgttgtttcgtgagctggcgttacccaacccggatacgattggcgatcgcttcccc
catcaggtctcgggcgggcagttacagcgtttgatgacggcgatggcgctgatcagcgat
ccggacgtggtgattctggatgaacccacgacggcgctggatgtcaccacccaggttgaa
gtgttgaaagcctttcgtcgggtggtcaaacagcgcggcgtaacggcaatttatgtcagt
catgacctggccgtggtggcacaaatggccgatcgtatccttgttctgctgcaaggtaaa
atcgctgagtacggcaccactgcgcacctgattggcgcgccgcaagcggactatacgcgc
ctgttgatggatgcggctcagcagaaagagcgccccagccactggtgcccggcgaaagcc
ggtgaactgccgctactggaagtgcgcgatctgtctgctggttacggcccgaaaggcagc
gatggcttacccaaagtgcgcattctggaaaacatcaatctgacgctctggaaaggtcag
gccatcggcattattggtgaatccggctcgggcaaaaccaccctggctcacgctatcgct
ggcctcaatccggcctgccaggggcaaatcttgtttaatggctacacggtggccgatcag
atgcaaaagcgcacggataacgagctgcgccgtattcagtatgttttccagatggcggat
acggcgctcaatccggcgcacagcgtggagcggattctgtcacgtcccctgacgctgttt
catggtctgagcggcatcgcccggcagaaccggctgtatcaacttctggatctggtgaag
ttgccgcgcacggtactctcgcgccgtccctggtcgttgtccggtgggcaaaagcagcgt
gtgaatctggcacgtgccctggcggcagaaccggatgtcattctctgtgatgaggtgacc
tcggcgctcgataccgtagtggcctcggcggtgctggatctgatcagtgaactgcgccgt
gagctgggattgtcggtaatgtttatcagccacgatatgcacgccgtgcgtgccgtgtgt
gacgagatcgttgtgatgcgcaatggcgctatcgtgacccagctggcacgcggtaactac
gatcaaccgaccagtgagctctatttcgaacgcctgaaacgtgcggttcctgagctacgt
cagggctggctggacgagcacgaagagattctgaaagccgaataa

DBGET integrated database retrieval system