KEGG   Pantoea ananatis AJ13355: PAJ_1712
Entry
PAJ_1712          CDS       T01969                                 

Gene name
dppC
Definition
(GenBank) dipeptide transport system permease protein DppC
  KO
K02034  peptide/nickel transport system permease protein
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:paj00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PAJ_1712 (dppC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paj02000]
    PAJ_1712 (dppC)
Transporters [BR:paj02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    PAJ_1712 (dppC)
SSDB
Motif
Pfam: BPD_transp_1 DUF5665 OppC_N
Other DBs
NCBI-ProteinID: BAK11792
UniProt: A0A0H3L4N3
Position
complement(2068407..2069267)
AA seq 286 aa
MEELMKILLPWRIFQSLSLSGQLGLVVTLFWLIIALFGTWWAPHNLDDIGAGPLMGGFTH
ENLLGTDYLGRDMLSRIMYGAKFSLGLALGAAVLASLIGTLLALLAAVTGRWLEELLGRI
NDAMLVLPGKILALMIVAVFGSSLPMLLITAVFTYWPGAFRIAFALASNLRNMDYVRASR
LRGESRWYIAIHDILPNMVHPVLADFGLRFVYIVLLLSGLSFLGLGVQPPYADWGTLVRE
NIQGLFDGSPAVLMPAVAIASLTIAVNLFIDSLQSMRPLTLAKEGA
NT seq 861 nt   +upstreamnt  +downstreamnt
atggaggagctgatgaaaatattgcttccctggcgcatttttcagtcactgtctttatcg
ggccagttaggcctggtggtgaccttgttctggctaattatcgcgctcttcggcacctgg
tgggcgccccacaatctcgacgacattggtgcgggcccgttaatggggggatttacgcat
gaaaacctgctgggtacggattacctggggcgggatatgctcagccgcattatgtacggg
gcgaaattttcccttggcctggcgctgggtgctgcggtgctggccagcctgattggcacc
ctgctggcgctgttagcagcggtgaccggacgctggctggaagagctgctgggccgtatc
aacgacgccatgctggtgttaccggggaaaatcctggcgctgatgatcgtggcagtgttc
ggatcttcattgccgatgctgctgattactgcggtattcacctactggcccggcgcattt
cgtatcgcctttgccctggccagcaacttgcgcaatatggattatgtccgcgcctcccga
ctgcggggagaaagccgctggtacatcgccatccacgatattctgcccaatatggtgcac
ccggtcctggccgattttggcctgcgttttgtgtatatcgttttactgctgagcgggctg
agcttccttggcctgggcgttcagccaccttatgccgactggggaacattagtgcgtgaa
aatattcaggggctgtttgatggttcaccggccgtgttgatgcccgcggtggccattgcc
agcctgaccatcgccgttaacctgtttattgacagcttgcaaagcatgcgtccgttgacg
ctggcaaaggagggggcatga

DBGET integrated database retrieval system