KEGG   Pantoea ananatis AJ13355: PAJ_1716
Entry
PAJ_1716          CDS       T01969                                 

Definition
(GenBank) hypothetical protein
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00361  Chlorocyclohexane and chlorobenzene degradation
paj00625  Chloroalkane and chloroalkene degradation
paj01100  Metabolic pathways
paj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PAJ_1716
   00361 Chlorocyclohexane and chlorobenzene degradation
    PAJ_1716
Enzymes [BR:paj01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     PAJ_1716
SSDB
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Other DBs
NCBI-ProteinID: BAK11796
UniProt: A0A0H3KXL6
Position
complement(2073276..2073944)
AA seq 222 aa
MALFKPKFITFDCYGTLIFFDMAGAAKRCFAERVDANAMDAFVADFSGYRLDEVLGAWKP
YYDVVSNAIQRTCKKWGVKWEQADSDFIYTDCATWGPHPDVPAGLAKVAKEFPLVLLTNS
MNDLIPHHIPRLGAPVHMAITAEEAGAYKPQMKGFEYMLEKLDCRPDEILHVSSSFRYDL
MTAHDLGIKHKVWVNRGHEPANPYYQYTEIKDIGGLPGVVGL
NT seq 669 nt   +upstreamnt  +downstreamnt
atggcactgtttaaacccaaattcatcacttttgattgttacggcacgctgatctttttt
gatatggcaggtgcagcaaagcgctgttttgcggagcgggtggacgcgaatgccatggat
gcctttgtcgctgacttttcgggctatcgtctggatgaggtgctgggtgcctggaagcct
tattacgacgtggtgagcaatgcgattcagcgcacctgtaaaaaatggggcgtgaaatgg
gagcaggcagacagtgattttatctacaccgactgcgccacctggggaccgcatccggat
gtgcccgccggattagccaaagtggcgaaagaatttccgctggtgctgctgaccaactca
atgaacgacctgattccgcatcacattcctcgtcttggcgcgcctgtgcatatggcgatt
acggcggaagaggccggtgcctataaacctcagatgaaaggctttgaatacatgctggaa
aaactggactgccgtccggacgaaattctgcatgtgtcatccagtttccgttatgacctg
atgaccgcgcacgacctgggcattaagcataaggtctgggtcaatcgcgggcatgaaccg
gccaatccctattatcaatacaccgaaattaaagatattggcggcctgcctggcgtcgtc
ggtctttga

DBGET integrated database retrieval system