KEGG   Pantoea ananatis AJ13355: PAJ_1717
Entry
PAJ_1717          CDS       T01969                                 

Gene name
betB
Definition
(GenBank) betaine aldehyde dehydrogenase BetB
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00010  Glycolysis / Gluconeogenesis
paj00053  Ascorbate and aldarate metabolism
paj00071  Fatty acid degradation
paj00280  Valine, leucine and isoleucine degradation
paj00310  Lysine degradation
paj00330  Arginine and proline metabolism
paj00340  Histidine metabolism
paj00380  Tryptophan metabolism
paj00410  beta-Alanine metabolism
paj00561  Glycerolipid metabolism
paj00620  Pyruvate metabolism
paj00625  Chloroalkane and chloroalkene degradation
paj00770  Pantothenate and CoA biosynthesis
paj00903  Limonene and pinene degradation
paj01100  Metabolic pathways
paj01110  Biosynthesis of secondary metabolites
paj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAJ_1717 (betB)
   00053 Ascorbate and aldarate metabolism
    PAJ_1717 (betB)
   00620 Pyruvate metabolism
    PAJ_1717 (betB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PAJ_1717 (betB)
   00561 Glycerolipid metabolism
    PAJ_1717 (betB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PAJ_1717 (betB)
   00310 Lysine degradation
    PAJ_1717 (betB)
   00330 Arginine and proline metabolism
    PAJ_1717 (betB)
   00340 Histidine metabolism
    PAJ_1717 (betB)
   00380 Tryptophan metabolism
    PAJ_1717 (betB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PAJ_1717 (betB)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    PAJ_1717 (betB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PAJ_1717 (betB)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PAJ_1717 (betB)
Enzymes [BR:paj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     PAJ_1717 (betB)
SSDB
Motif
Pfam: Aldedh DUF2917
Other DBs
NCBI-ProteinID: BAK11797
UniProt: A0A0H3L4N6
Position
complement(2073977..2075473)
AA seq 498 aa
MGVTNKDSSMLSFDPESVPLPLGHYIGGKHVQTQGESFAVKRPSDGRVFATLHEAQAEDV
DRAVMTAHQALKTSGWSGCSPRERGRVLRRWADLIEQDLLLAQLEALGSTRPIADVVQHE
IPFTAEAIRFYAECADKYSGDLFPTRDSSLGMLIAEPYGVIGAITPWNFPLSMASWKCGP
ALAAGNAVVLKPSELTPLSTVRMAELAVQAGLPAGILNIVQGSGAVTGSALVRHPRVRKV
SFTGSTLTGARIMSDAAQFGMKPVTLELGGKSPQLVFDDAGDIEVLAQRILRGFTANGGQ
ACVAGTRLIVQRGIADALTERLAALCREARPGVTWQDTSRYAPLIDARQGNKVRSVIEDA
KAQGAEVLVGGERFADTDEGWFWQPTLLSQVKQDNPAVQQEIFGPVLTIQTFDDEEQGLA
LAAHDTYGLCAGVHTLSLPRAMRAIRAIDAGTVWVNRYGRSGDFIIPTGGFLGSGIGKDL
GRQAFQACQRQKSVLIDF
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgggtgtaacaaataaggattcttccatgttgagtttcgacccggaaagcgtgccactc
ccgttaggccattatatcggcgggaaacatgtgcaaacacaaggcgaatcttttgccgtt
aaacgcccctcagatggtcgtgtttttgccaccctgcatgaagcgcaggcggaagatgtt
gatcgtgccgtgatgacggcgcatcaggcactaaaaaccagcggctggtcaggttgttcc
ccccgtgaacgcggtcgggttttgcgccgctgggcggacttaatcgaacaggatctgctg
ctggcccagcttgaagcacttggctcaacgcgtccgatcgccgacgtggtacagcatgaa
attcccttcaccgccgaagccattcgtttctatgccgaatgtgctgacaaatacagcggt
gacctgtttcccacgcgggatagcagcctgggaatgctgattgccgaaccctatggcgtg
atcggggcgattacgccctggaatttccccctgtcgatggcctcgtggaaatgcgggccg
gccctggcagcaggaaatgcggtggtgctgaaaccctctgaactcaccccgctttctacc
gtgcgcatggcagagctggcggttcaggctggtttacccgctggcatcctgaatatcgtg
cagggcagcggggcggtaacgggcagcgcgctcgtcagacatccgcgagtgcgcaaagtg
tctttcaccggttccaccctgaccggagcgcgcatcatgagcgatgccgcacagtttggc
atgaagcccgttacgctggaactgggcggtaaaagcccccaactggttttcgatgatgca
ggggatattgaggtgctggcgcagcgtattctgcgcggcttcaccgcaaatggcggccag
gcctgcgttgcgggtacgcgcttaatcgtgcagcgcggcattgccgatgcgctgacggaa
cggctggcggcgttatgtcgtgaggccaggccaggcgttacatggcaggacacctcgcgt
tatgcaccgctgattgatgcgcgccagggcaataaagtgcgttcggtcattgaagatgcc
aaagcgcagggcgctgaggtgctggtaggcggcgaacgcttcgcggacaccgatgagggc
tggttctggcaacccacgctgttaagccaggtgaagcaggataatccggcggtacagcag
gaaatttttggtccggtactgaccattcagaccttcgacgatgaagagcaggggctggcg
ctggcagcacatgatacgtacggcctgtgtgccggtgtgcatacgctgagcctgccacgg
gccatgcgggcgatacgggcgattgacgccggtaccgtgtgggtcaatcgctatggacgc
tccggcgatttcatcattccaaccggcggttttctgggctcgggtattggtaaagatttg
ggacgccaggcgttccaggcctgccagcgccagaaaagcgtacttatcgatttttaa

DBGET integrated database retrieval system