KEGG   Pantoea ananatis AJ13355: PAJ_1718
Entry
PAJ_1718          CDS       T01969                                 

Gene name
gabD
Definition
(GenBank) succinate-semialdehyde dehydrogenase [NADP+] GabD
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00250  Alanine, aspartate and glutamate metabolism
paj00310  Lysine degradation
paj00350  Tyrosine metabolism
paj00650  Butanoate metabolism
paj00760  Nicotinate and nicotinamide metabolism
paj01100  Metabolic pathways
paj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PAJ_1718 (gabD)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PAJ_1718 (gabD)
   00310 Lysine degradation
    PAJ_1718 (gabD)
   00350 Tyrosine metabolism
    PAJ_1718 (gabD)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PAJ_1718 (gabD)
Enzymes [BR:paj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     PAJ_1718 (gabD)
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     PAJ_1718 (gabD)
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     PAJ_1718 (gabD)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: BAK11798
UniProt: A0A0H3KXI9
Position
complement(2075801..2077258)
AA seq 485 aa
MSRIQLKDHTLLRQQALFAGQWQNGYQGETLPVIDPATGETLATVPALGLKETEAAIDHA
ESVRHDWAKTPNATRAALLEKWYQLIIDNADDLAIIMTAEQGKPLAEARGEVLYGASFVK
WFAEEARRIYGDTIPAPTSDRRIIVLKQPVGVAAAITPWNFPIAMITRKVAPALAAGCPI
IVKPSDLTPLSALALAVLAERAGFPSGVLQVVTGMPTEIGAALTESRLVRKISFTGSTRV
GQLLMKQCADSVKRLSLELGGNAPLIVFDDADIEIAVAGVMTSKFRNAGQTCVCANRILV
QRNIYERFSARLLEAVATLKVGDGFAAGSTLGPLINTAAVEKVNAHIDDALQKGATLLTG
GISSGAGTWVQPTVLGQVTSEMRIAQEETFGPVAPLFVFDDEAQALAMANDTPYGLGAYF
FTENIRRAWRVAEALEFGMVGFNTGVISLEVAPFGGVKLSGIGREGSRYGIDEYLEQKTF
HLGSL
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgtcacgtatacaactaaaagatcacacgctgttgcgtcagcaggcgctgtttgcgggt
caatggcagaacggttatcagggcgaaacgctgccggttatcgatccggcaaccggtgag
acgctggcgacggttccggcgctggggctgaaggaaaccgaggcggcgatcgatcatgcg
gagtcggtacgccatgactgggctaaaacacccaacgccacacgcgccgcactgctggaa
aagtggtatcagttgattatcgataacgccgacgatcttgccatcatcatgacggccgag
cagggcaaaccgctggcggaagccagaggcgaagtcctttacggagccagtttcgttaag
tggtttgccgaagaggcgcgtcgcatttacggcgataccattcccgcgcccacgtccgac
cgcagaatcatcgtgttaaaacagccggtcggcgtagcggcagccattacgccgtggaat
tttcccattgccatgattacccgcaaggtggcgcctgcgctggcggcgggttgtccgatt
atcgttaaaccttctgacctgacgccgctgtctgccctggcgctggcggttctggcagag
cgcgccggctttccgtccggtgttttgcaggtggtcaccggtatgccgacggaaattggc
gccgcactgaccgaaagccgcctggtgcgtaaaatttcattcaccggctcaacccgtgtg
ggtcagttactgatgaaacaatgtgccgacagcgtaaaacggttgagtctggaactgggc
ggcaacgcgccgttaatcgttttcgatgacgccgatattgagatcgcggtggctggcgtc
atgaccagcaaattccgtaacgccgggcaaacctgtgtctgcgccaaccggattctggta
cagcgcaacatctatgaacgcttttccgcccgcttactggaagccgtggccaccctcaag
gtgggcgacggatttgcggccggtagcaccctcgggcccctgatcaataccgccgcggtt
gaaaaggtcaatgcacatatcgacgatgccttacagaaaggggcgacgctgttaacgggc
ggcatcagcagcggagcgggaacctgggttcagcctaccgttctggggcaggtgacgagt
gagatgcgcattgcgcaggaagagacctttggcccggtggcaccactgtttgtgtttgac
gatgaggcgcaggcattggcgatggcgaacgacacgccttatggcctgggcgcgtatttc
ttcacggagaatattcgacgcgcctggcgggtagcggaagcgctggaatttggcatggta
ggatttaatacgggcgtaatctctttagaagtggcgccctttggcggcgttaaattatcg
ggaatcggtcgtgaaggttcacgttacggaattgatgaatatctggaacaaaaaacattc
catctcggcagtttgtaa

DBGET integrated database retrieval system