KEGG   Pantoea ananatis AJ13355: PAJ_1719
Entry
PAJ_1719          CDS       T01969                                 

Gene name
cbl
Definition
(GenBank) HTH-type transcriptional regulator Cbl
  KO
K13635  LysR family transcriptional regulator, cys regulon transcriptional activator
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:paj03000]
    PAJ_1719 (cbl)
Transcription factors [BR:paj03000]
 Prokaryotic type
  Helix-turn-helix
   LysR family
    PAJ_1719 (cbl)
SSDB
Motif
Pfam: LysR_substrate
Other DBs
NCBI-ProteinID: BAK11799
UniProt: A0A0H3KX84
Position
complement(2077410..2078195)
AA seq 261 aa
MTEPGKALLTIAERILDEAGKVRRLADVFTNESSGILSIATTHTQARYSLPPVIKAFRQL
YPNVRLELNQGSPQEIVNMLLAGEVDVGIASEMLVNNSSLAAFPWFSWHHALLVPHDHEL
VQQQPVSLNALSHHPLITYRQGITGRSRVDRAFQGAGLKPDIVLSAQDSDVVKTYVKLGL
GVGILADQACETEPGGELVRLDATHLFEANTVWLGLKRGQLQRNYVWQFLELCNANLSLE
EIKEQALSSSGDDEPVIDFQI
NT seq 786 nt   +upstreamnt  +downstreamnt
atgacagagcccgggaaagcgctattaaccattgcggagcgcattttggacgaagccggt
aaagtccgccgtctggctgacgtgtttaccaatgaatccagcggtatcctttccatcgcc
accacgcatacgcaggcgcgttacagtctgccgcccgtcatcaaggcgtttcgccagctt
tatcccaacgtcaggcttgaactgaaccagggctcaccgcaggaaattgtgaacatgctg
ctggcaggcgaggtggatgtcggaattgccagtgagatgctggtgaataacagcagcctg
gcggcgtttccgtggtttagctggcatcatgccctgctggtgccgcacgatcacgagctg
gtgcagcaacagccggtatcgctcaatgcgctcagtcaccatccgctcattacttatcgc
caggggattaccgggcgttcacgtgtggaccgggccttccagggggcaggcttaaagccg
gacatcgtgctcagcgcacaggattccgatgtggtgaaaacctatgtcaaacttggcctt
ggtgtcggtattctggccgatcaggcctgtgaaaccgaaccgggcggtgagctggtcagg
ctggatgccacgcatctgtttgaggctaataccgtgtggctggggctgaagcggggccaa
ctgcagcgcaactatgtctggcaatttctggagctgtgcaacgccaacttatcgcttgaa
gagattaaagagcaggcactgtcctcctcgggtgacgatgagccggttatcgattttcag
atttag

DBGET integrated database retrieval system