KEGG   Pantoea ananatis AJ13355: PAJ_1720
Entry
PAJ_1720          CDS       T01969                                 

Gene name
nac
Definition
(GenBank) nitrogen assimilation regulatory protein Nac
  KO
K19338  LysR family transcriptional regulator, nitrogen assimilation regulatory protein
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:paj03000]
    PAJ_1720 (nac)
Transcription factors [BR:paj03000]
 Prokaryotic type
  Helix-turn-helix
   LysR family
    PAJ_1720 (nac)
SSDB
Motif
Pfam: LysR_substrate HTH_1
Other DBs
NCBI-ProteinID: BAK11800
UniProt: A0A0H3L1R0
Position
complement(2078580..2079497)
AA seq 305 aa
MNLRRLKYFVKIVDIGSLTRAAEVLHIAQPALSQQVATLEGELEQQLLNRTKRGVTPTEA
GKLLYSHARVILRQCELAQSAVMNAGEVVKGQVSIGLAPGTAASSLTMPLLQTVREQYPD
IIVYLHENSSSALNENIISGQLDMAVLYDRAPTAGINSLPLLKEDLYLVGTTACPGTNVD
LAEVAQMSLFLPRDYSAVRQRVDEAFSLRRLSARIIGEIESLSTLTAAISSGMGVTVLPE
SAARALVGSTQAWMARITSPTISLPLSLNLSHRLPLSPPAQAVKNILLSLLNKPLTEKRE
LTLVS
NT seq 918 nt   +upstreamnt  +downstreamnt
atgaatttaagacggctgaaatactttgtgaaaatcgtcgatatcggtagcctgacgcgg
gcagcagaagtgctgcatattgcccagcctgcgttaagccagcaggttgctacgcttgaa
ggtgagctggagcagcagcttctgaatcgcaccaaacgcggcgtaacacctacggaagcc
ggaaaattactctacagccatgcgcgcgttattctgcgacagtgtgagctggcacagtca
gcggtgatgaatgccggtgaagtggtgaaagggcaggtttccattggactggctcccgga
acggccgcctcctcgctgacgatgccattgctgcaaacggtacgggaacagtatccggat
atcattgtttacctgcatgaaaacagcagcagcgccctgaatgaaaacattattagcggg
cagctggatatggccgtgctgtatgaccgtgcgccgacggcagggatcaacagtctaccg
ctgctcaaagaagatctgtatctggtcggcaccactgcctgtccgggtaccaatgtggat
ctggctgaagtggcacagatgagcctgtttttgccacgcgattacagtgccgtgcgtcag
cgcgttgacgaggcattttcactgcgccgcctgagtgcgcgtattattggtgaaatagag
tcgctttccacgctgaccgccgcgatatccagcgggatgggcgtcactgtattgccggaa
tccgccgcccgggcgctggtgggttccacccaggcatggatggcgcgtattaccagcccg
acgatcagcctgccgttatcgcttaacctttcacatcggttacctttatcgcccccggcg
caggccgttaaaaatatcctgctgtcgctgctgaacaaaccgctgacggaaaaacgggaa
ctcaccctggtcagctag

DBGET integrated database retrieval system