KEGG   Pantoea ananatis AJ13355: PAJ_1721
Entry
PAJ_1721          CDS       T01969                                 

Gene name
rbsC
Definition
(GenBank) ribose transport system permease protein RbsC
  KO
K17214  inositol transport system permease protein
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:paj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PAJ_1721 (rbsC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paj02000]
    PAJ_1721 (rbsC)
Transporters [BR:paj02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Inositol transporter
    PAJ_1721 (rbsC)
SSDB
Motif
Pfam: BPD_transp_2 DUF1427
Other DBs
NCBI-ProteinID: BAK11801
UniProt: A0A0H3KXM6
Position
complement(2080270..2081322)
AA seq 350 aa
MRRETTMSNMKATAAQASQQQPSFLASLRHRVPKDTGIFVVMVGIALIFEIFGWYVRDQS
FLMNTNRLILIVLQVAIIGIIAVGVTQVIITTGIDLSSGSVIALTAVVAASLAQTSDTLT
PMFPSLVNMPAAVPIAAGIGVGLLCGLINGVLITRTGIPPFIATLGMMVSARGLAQYYTQ
GNPISFLSDGFTSIGQGAMPVVIFLVVALVFHVALKHTRYGKYVYAIGGNMTSAKVSGIN
VNKYLIMVYTIAGALSGLAGVVLAARVSSGQSSMGVGYELDAIAAAVIGGSSLMGGVGRI
TGTLIGAVILGLIKSGFTFVGVDAYIQDIIKGIIIVAAVTIDMRRNRAKR
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgaggcgcgaaaccacgatgagtaatatgaaagccacggccgctcaggcttctcagcaa
caaccctctttcctggcaagcctgcgtcaccgggttccaaaggataccggcatctttgtg
gtaatggtggggattgccttaatttttgaaatttttggctggtatgttcgcgatcagtcg
ttcctgatgaacacgaaccgcctgattttaatcgtattgcaggtcgctatcatcggtatc
atcgccgtcggtgtaacccaggtgatcattacgaccggtatcgatctctcttccggttcg
gtgattgcgttgactgcggtggtggctgccagcctggcgcaaacctcagatacgctgacg
ccgatgtttccatccctggtgaatatgcctgcggccgtgccgattgctgccggtattggc
gtcggtttactgtgcgggttgatcaatggcgtattgattacccgcaccggcatcccacct
tttattgccacactgggcatgatggtttctgcgcgcggtctggcgcagtattacacccag
ggtaaccccatcagttttctgtccgatggattcacctctattggtcagggtgccatgccg
gtggtgatttttctggttgtggcgctggtgtttcacgttgcgctgaaacatacccgttat
ggcaaatatgtttatgccatcggcggcaatatgacgtcggccaaagtgtccggcattaac
gtcaacaaatacctgatcatggtttacaccattgcgggggcgctgtcaggcctggcaggc
gtagtgctggcggcacgcgtcagcagcggccagtcaagcatgggcgtgggctacgaactg
gatgcgattgccgcagcggtgatcggcggcagcagcctgatgggtggagtgggccgtatt
accggcacgctgattggtgcggtaattcttggtctgattaaaagcggattcacctttgtt
ggggtggatgcctatatccaggacatcatcaaaggcatcatcattgttgccgcagttacc
atcgatatgcgacgcaatcgcgctaaacgctaa

DBGET integrated database retrieval system