KEGG   Pantoea ananatis AJ13355: PAJ_1722
Entry
PAJ_1722          CDS       T01969                                 

Gene name
mglA
Definition
(GenBank) galactoside transport ATP-binding protein MglA
  KO
K17215  inositol transport system ATP-binding protein
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:paj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PAJ_1722 (mglA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paj02000]
    PAJ_1722 (mglA)
Transporters [BR:paj02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Inositol transporter
    PAJ_1722 (mglA)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 SMC_N RsgA_GTPase MukB AAA_16 AAA_22 AAA_23 AAA_30 MMR_HSR1
Other DBs
NCBI-ProteinID: BAK11802
UniProt: A0A0H3L4P0
Position
complement(2081319..2082803)
AA seq 494 aa
MTAFALEAEGISKFFPGVKALDNVSLRVRSGTVHALMGENGAGKSTLMKCLIGIYRPDQG
TIKIKGEPVQFRDTMDALRSGVSMIHQELNLVPHMTVAENIWLGREPMKFGFVDHARLNK
DTQALLNRLNIKLKADRMVGELSIASQQMVEIAKAVSWDADIVIMDEPTSALTETEVAHL
FTIIRDLREQGKAIVYISHKMDEIFSITDEISVFRDGSWVGSDSTSAFTRQSLITKMVGR
ELTQLFPKFNNAIGEEVLTVRHLSCKDRFTDVSFGVRRGEILGVAGLVGAGRSEVMESLF
GMTHFDSGEILIDGIPANIDSPSVAIEKGMAFLTEDRKKSGLFLVLSVLENMSIVNMPEY
SGKSGFVSHVKMAQDCMDQIRRLNIKTPTMDQIINNLSGGNQQKVLIARWLLAQPKILIL
DEPTRGIDVGAKAEIYRLISELANRGVAIIMVSSELPEILGMSDRIMVMHGGRITGILDK
EEADQETILSLASE
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgaccgcttttgcgcttgaagccgaaggcatcagcaagttctttccgggtgtgaaggca
ctggacaatgtgtcgctgcgcgtccgctctggaacggtacatgctttgatgggtgaaaat
ggcgcgggcaaatccactttaatgaagtgcctgatcgggatttaccgtcccgatcagggc
accatcaagattaaaggggagccagtgcagttcagggacaccatggatgcgttacgttcg
ggtgtgtcaatgatccaccaggagctgaatctggtgccgcacatgaccgtggccgaaaat
atctggctgggtcgggagccgatgaaatttggttttgtcgatcatgcccggctaaataaa
gacacgcaggcgctgcttaaccggctcaatatcaaactgaaagccgaccgcatggtaggc
gaactgagcatcgcctcacagcagatggtggaaatcgccaaagcggtgtcctgggatgcc
gacattgtcattatggatgagcccacctccgcgttgacggaaaccgaagtcgcacattta
tttaccatcattcgcgatctgcgcgaacagggtaaagccatcgtttatatcagtcacaaa
atggatgagatcttttccatcacggatgagatcagcgtgtttcgtgacggcagttgggtg
ggcagcgacagcaccagtgcgttcacgcgccagtctctgatcactaaaatggtcgggcgt
gagctgacacagcttttccctaaattcaacaatgccatcggggaagaggtgctgaccgtt
cgtcatctgagctgcaaagaccgcttcaccgacgtcagtttcggtgtgcgccggggagaa
attctcggtgtggcaggcctggtcggagccgggcgcagcgaagtgatggaaagcctgttt
ggcatgacgcattttgacagcggcgaaattctgattgacggcatcccggcgaatattgac
tcaccgtcggtcgccatcgaaaagggcatggcatttttgactgaagatcgtaaaaagtca
ggattgtttttggtgttgtcggtgctggagaacatgagcattgtcaacatgccggaatac
agcggcaaaagcggctttgtcagccatgtcaaaatggctcaggactgcatggatcaaatt
cgccgtctgaatattaaaacccctaccatggatcaaatcatcaataacctgagcggcggc
aatcagcagaaagtgcttatcgcccgctggctattggctcaaccgaaaatcctgatcctg
gatgagccgacgcgcggcattgatgttggggcaaaagcagaaatttatcgtttgattagt
gagcttgccaaccgtggcgttgccatcattatggtgtcctcagagctgcctgaaattctg
ggcatgagtgaccgcatcatggtgatgcatggtgggcgcattaccggcatcctcgataaa
gaagaggccgatcaggaaactattttgtcgttagcatccgaatga

DBGET integrated database retrieval system