KEGG   Pantoea ananatis AJ13355: PAJ_1723
Entry
PAJ_1723          CDS       T01969                                 

Gene name
mocB
Definition
(GenBank) putative rhizopine-binding protein precursor MocB
  KO
K17213  inositol transport system substrate-binding protein
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:paj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PAJ_1723 (mocB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paj02000]
    PAJ_1723 (mocB)
Transporters [BR:paj02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Inositol transporter
    PAJ_1723 (mocB)
SSDB
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_6 Peripla_BP_3
Other DBs
NCBI-ProteinID: BAK11803
UniProt: A0A0H3KXJ5
Position
complement(2082834..2083757)
AA seq 307 aa
MNIKKTIVASLLACMLPAAAMAKDISVGVSMAVFDDNFLTIVRNAVQNEMKKDGVKGQIE
DAKGDVAQQLQQVQNFIGQGVDAIIVNPVDTDAVKPIIDQASKAGVALVFVNRKPQAQLG
DKMAFVGSDSELAGRLQMEALAKAMNGKGNVAILLGDLANESTRERTKGVEAVVAKYPNI
KVVQKQTAKFSRNDAVDVVSNWMTAGDDINAIASNNDEMAIGAIQALGKNDKHILVAGVD
GTPDALQMIKNGKMVASVFQDAKGQGEGAVQTAIKLANGEKVQKIVDIPFQLITKDNYTK
YTSMNQK
NT seq 924 nt   +upstreamnt  +downstreamnt
atgaacatcaaaaaaacgattgttgcctcactgttagcctgcatgttgcccgccgctgcg
atggcgaaagatatttccgtgggtgtttctatggcggtgtttgatgacaactttctgacg
attgtgcgtaacgctgtacaaaatgagatgaaaaaagatggcgtcaaaggccagatcgaa
gatgccaaaggcgatgtggcccagcagctccagcaggtacagaactttattggacagggc
gttgacgccatcattgttaaccccgtcgacactgacgctgtaaaacccattatcgatcag
gcgtccaaggccggtgtggcgttggtatttgttaaccgtaaaccccaggcccagctaggc
gacaaaatggcgtttgtgggctctgactctgaactggcgggccgtctgcagatggaagcc
ctggcgaaggcgatgaacggcaagggcaacgttgccattttattaggtgatctggctaac
gaatcgacccgcgaacgcaccaaaggcgtggaagccgtagtggcgaaatacccgaatatt
aaagtggtgcaaaagcagacggcgaaattcagccgcaacgatgcggtagatgtcgtgagc
aactggatgaccgctggcgatgatatcaatgccatcgcgtcaaacaatgatgaaatggcg
attggtgccattcaggcattaggcaagaacgataaacacattctggtggcaggcgtggat
ggcacaccggatgcgttgcagatgatcaagaacggcaagatggtggccagcgtattccag
gatgcaaaagggcagggtgaaggcgctgttcagaccgcaatcaaactggcaaacggtgaa
aaagtgcagaagattgttgatatcccattccagctgatcaccaaagacaactacaccaaa
tataccagcatgaaccaaaaataa

DBGET integrated database retrieval system