KEGG   Pantoea ananatis AJ13355: PAJ_1724
Entry
PAJ_1724          CDS       T01969                                 

Gene name
tcp
Definition
(GenBank) methyl-accepting chemotaxis citrate transducer Tcp
  KO
K03406  methyl-accepting chemotaxis protein
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj02020  Two-component system
paj02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:paj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAJ_1724 (tcp)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    PAJ_1724 (tcp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:paj02035]
    PAJ_1724 (tcp)
Bacterial motility proteins [BR:paj02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    PAJ_1724 (tcp)
SSDB
Motif
Pfam: MCPsignal 4HB_MCP_1 DUF4200 DUF2165 HAMP
Other DBs
NCBI-ProteinID: BAK11804
UniProt: A0A0H3KX90
Position
2085131..2086678
AA seq 515 aa
MMKVSTRLSAGFAFLILLFVISSAVAISNLLETRQNIDEIVNTNLKKVTLSNDAGTALRN
MLVEVRNMALFSDQKAIENEWGRFETQKGVYTQKRTELASMIERDHNQQEIGLLRKVQQN
EQAALTTLATAANMGRQRQLNGLADYLTNVVRPPQQILISSLNELTDMQRAFAENTAVES
NASASRVIKTFIALIIATVISGALICFVISRKLMRQLGGEPAQAQALAATIASGDLTSTV
LLRRNDTSSLLASLDSMQARLRGLVSQIKDASTSVALAADEIAQGNTELSSRTEQQAAAL
QETAASMEQLTATVKSNTAGAQQTAESARDTARLARSGEADVQRMSGTMQDISVSAAKVR
DITSVIESIAFQTNILALNAAVEAARAGEEGRGFAVVAGEVRTLAQRSATAARDIKVLIE
QAVEQVESGVAVASSTGQSIIKIVGMVGELAEAMDSLSLASSEQMQGISQVSVAVSQMDG
VTQNNAALVEESSSASRSLSEQAQALRGMVAAFHV
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgatgaaggtatcgacacgactgtctgctggctttgcttttttgatactgcttttcgtc
atcagttcagcggttgcaatcagcaatctgcttgagacgcgtcagaatattgatgagatc
gtcaacaccaaccttaaaaaagtgactttgtctaatgatgcaggtacggcgctgagaaac
atgcttgttgaggtgagaaacatggcgctcttctctgatcaaaaagcaattgagaatgag
tggggccgctttgaaactcagaaaggggtttatacccagaaacgcactgagcttgcatcc
atgatcgaacgcgaccataaccagcaggaaattggcctactcaggaaagtacagcagaat
gaacaggccgcgctcacgacactcgcgacggcggcaaacatgggcaggcagagacaactg
aatggcctcgcagattatctgaccaacgttgttcgtccccctcagcaaatccttatctcc
agtctcaacgaactcacggacatgcagcgtgcctttgctgaaaacaccgccgtggaaagt
aacgcatccgccagccgcgttatcaaaacctttattgctctcatcattgcaaccgtcatt
tccggcgccctgatttgtttcgtcatcagcaggaagctgatgcggcaactgggcggtgaa
cctgcacaggctcaggcgctggccgcgaccatcgcttccggggacctcacctccaccgtg
ctgctgcgtcgcaacgacaccagcagcctgctcgcctcactggacagcatgcaggccagg
ctgcgcggcctggtatcgcagataaaggatgcttccacttccgtggcgctggcggccgac
gaaatcgcccagggcaacaccgagctgtcgtcacgaaccgagcagcaggcggccgccctg
caggaaaccgctgccagcatggagcagctgaccgccacggtgaagagcaacaccgctggc
gcgcagcaaaccgctgaatcggcccgcgatacggcccgcctggcccgttcgggtgaggcc
gacgtgcagcggatgtctggcacgatgcaggatatttccgtcagtgccgctaaagtccgg
gacattacctcggtcattgaaagcatcgcgtttcagaccaacatcctggccctgaacgcc
gcggtggaggcggcgcgcgccggcgaggaaggccgcggttttgccgtggtggccggtgag
gtgcgcacgctggcgcagcgcagcgccacggcggcccgcgatatcaaagtcctgattgaa
caggccgttgagcaagtggaaagtggcgttgccgtggcctcctcgaccgggcagagcatc
atcaaaattgtcgggatggtcggcgagctggcggaggccatggactccctctctctggcg
tcctccgagcagatgcaggggatttcacaggtcagcgtggcggtgagtcagatggacggc
gtgacgcagaacaatgcggcgctggtcgaggagtcgtcttcagcctcgcgttcgctgtct
gaacaggcgcaggcgctgcgcggtatggtagcggcgtttcatgtctga

DBGET integrated database retrieval system