KEGG   Pantoea ananatis AJ13355: PAJ_1725
Entry
PAJ_1725          CDS       T01969                                 

Gene name
paaE
Definition
(GenBank) ferredoxin PaaE
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: Fer2
Other DBs
NCBI-ProteinID: BAK11805
UniProt: A0A0H3L1R7
Position
complement(2086988..2087137)
AA seq 49 aa
MGICGTCKVKCLEGEVEMNHNGGIPDEDVEEGYILSCCSIPKGNIVVEF
NT seq 150 nt   +upstreamnt  +downstreamnt
atggggatctgcggcacctgcaaggtgaaatgcctggaaggggaagtggagatgaaccac
aacggcggcatccccgatgaggacgtagaagagggctatattttgtcgtgctgtagcatt
cccaaaggcaatattgtcgtcgagttttaa

DBGET integrated database retrieval system