KEGG   Pantoea ananatis AJ13355: PAJ_1726
Entry
PAJ_1726          CDS       T01969                                 

Definition
(GenBank) hypothetical protein
  KO
K01173  endonuclease G, mitochondrial
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:paj03029]
    PAJ_1726
Mitochondrial biogenesis [BR:paj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    PAJ_1726
SSDB
Motif
Pfam: Endonuclease_NS Trypsin_2
Other DBs
NCBI-ProteinID: BAK11806
UniProt: A0A0H3KXN1
Position
complement(2087202..2089067)
AA seq 621 aa
MCRLFRDKQLWLKRANPTMEMRMNEQLKAQIASRLAITAGQRQQTRTALSQGQQAEPDSR
RAQRYAFQQRARQSVIMGANDLLPVSFLQQGLRAARAVALVREDGIPKGSGFLTYGNLFV
TNHHVLPEAAISGRITLQFGYRQGESGEILPGRLYAVDAESFWLSSPTEAFDCTLIALGE
ALTDSGEQPLPLALNDRNDKHALGISLNLIHHPGGAPQQITLRNNALLARHEQFLHYEAD
SEGGSSGAPVFNDGWQLVALHHGATEDSGKWVNEGIRMSALTDWLKGELPALSPHGQAIL
MQALTADNAPLLPESSAAAPDENYSNRDGFQADFLADNPVDMAQIIAPRAGEVAPLRDGR
NGADARLNYEHFSLLMSAERKLAFFTATNIDGARYINIDRGSGQPSLLPEGDRWYEDSRI
DSRYVTGQSFYSAFSRWFDRGHLTRRSDPTWGTAAEAVRANKDTFHFTNCSPQHFRFNQS
VQYWQGVERYILEYGVLKTKQQISVLTGPVLNDQHRQYGDLQVPLLFWKVVLRIGPQGTP
QATALLVSQDKLLDEPRRVLPLLQPEAAPQVDEYRVAVRSLETLTGLDFSAFRDWDSWQP
DPSLLAEPVQAKLIMTWPELL
NT seq 1866 nt   +upstreamnt  +downstreamnt
atgtgccgcctgttccgtgataaacagctatggttaaagagagcaaacccaaccatggag
atgcgaatgaacgagcaactgaaagcgcagatagcctcaaggctggcgattacggccggg
caacggcagcagacgcgcactgcgctcagccagggccagcaggcggaaccggactcacga
cgagcgcagcgctatgcgtttcaacagcgggcccgccagagcgtcattatgggcgctaat
gacttgctgccggtgtcatttttacagcaggggttacgcgcagcccgcgccgtcgcgctg
gtcagagaagatggcatacctaagggaagtggatttctgacctatggcaacctcttcgtc
acgaatcatcacgtgctgcctgaagccgccatttcgggccgcatcacgctgcagttcggt
tatcgccagggcgaatccggcgaaattcttccaggacgtctctatgcggtggatgccgag
agtttctggctttccagcccaacggaggcgttcgactgtacgttaatagcgcttggcgag
gcgcttaccgacagcggtgagcaaccgctgccgctggcacttaacgatcgtaatgataaa
catgcgctgggcatcagcctcaatctcatccatcatccgggcggtgcgccacagcaaatc
acgctgcgcaacaatgccctgttagcacgtcacgaacagtttctgcactatgaggccgac
agtgaaggcggctcgtcaggtgcaccggtcttcaacgacggctggcagctggtagccctt
catcatggcgccacagaagacagcggaaaatgggttaacgaaggcattcgcatgagtgcg
ctcaccgactggctgaagggcgagttgccagcgctgtccccgcatgggcaggcaatcctg
atgcaggcgctcacggccgataatgcaccgctactgcctgagtccagtgccgccgcgcca
gatgaaaactactctaatcgtgacggttttcaggcagactttctggcggacaatcctgtc
gacatggcacagattatcgcgccgcgtgcaggggaagtcgcccctctgcgtgacgggcgc
aacggcgctgatgccaggctgaattacgagcatttttctctgctcatgagcgctgagcgg
aagctggcattttttaccgccaccaatatcgatggggcacgctatatcaacattgaccgc
ggcagtgggcaaccttcgctgttgcccgaaggtgaccgctggtatgaagacagccgcatc
gacagccgctatgttactggtcagtcgttttatagcgcgttcagtcgctggttcgatcgc
ggtcatctcacccgccgcagcgatcccacctggggcacggcggccgaggcggtgcgcgcc
aataaagacacgttccacttcaccaattgttccccgcagcattttcgctttaaccagagc
gtgcagtactggcaaggggttgagcgctatatcctggaatacggcgtgttaaaaaccaaa
cagcaaattagtgtactgaccggcccggtactgaacgatcaacatcggcagtacggggat
ttgcaggtcccgctgctgttctggaaggtcgttctgcgcatcggtccacagggcacgccg
caggccaccgcactgctggtcagtcaggataagctgctggatgagcctcgccgcgtgttg
ccgcttttacaaccggaagcggcgccgcaggtggatgaatatcgcgtggcggttcgttca
ctggaaaccctgaccgggcttgatttcagcgcatttcgcgactgggacagctggcagccc
gatcccagcctgctggccgagcctgtgcaggcaaagctgattatgacgtggccggagcta
ttgtaa

DBGET integrated database retrieval system