KEGG   Pantoea ananatis AJ13355: PAJ_1727
Entry
PAJ_1727          CDS       T01969                                 

Gene name
lrp
Definition
(GenBank) leucine-responsive regulatory protein Lrp
  KO
K03719  Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:paj03000]
    PAJ_1727 (lrp)
   03036 Chromosome and associated proteins [BR:paj03036]
    PAJ_1727 (lrp)
Transcription factors [BR:paj03000]
 Prokaryotic type
  Helix-turn-helix
   Lrp/AsnC family
    PAJ_1727 (lrp)
Chromosome and associated proteins [BR:paj03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    PAJ_1727 (lrp)
SSDB
Motif
Pfam: HTH_24 AsnC_trans_reg HTH_AsnC-type MarR HTH_Crp_2 HTH_20 HTH_5 HTH_11 HTH_CodY TrmB HTH_IclR HTH_34 MarR_2 Crp
Other DBs
NCBI-ProteinID: BAK11807
UniProt: A0A0H3L4P6
Position
complement(2090347..2090826)
AA seq 159 aa
MTDMPLDKTEVKILSILQDDARMTNQELADKIGMSASPCWRKVRKLEEQGVIKGYRAVLD
RKKTGSGVMVFIRVVIDCHSEAEAEKFEQQVTALEDVVACYSIGGDADFLLQVVATDLDS
YAEFAMSVVRRLPRIKEMQSMFVLKEIKPLTSFPVKNLG
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactgatatgccgcttgataagacagaggtgaaaattttaagcatcttgcaggatgat
gcccggatgaccaatcaggagcttgccgataagatcggtatgtctgcctcgccctgctgg
cgcaaagtccgcaaactggaagagcagggcgtgataaagggctatcgggcagtgctggac
cgtaagaaaaccggctcgggcgttatggtttttattcgggtggtcattgactgccacagc
gaagctgaagcggaaaagtttgagcagcaggtgaccgcgctagaggatgttgtggcctgc
tacagcattgggggcgacgccgattttttgttacaggtggtggcaaccgacctcgactct
tacgccgagtttgccatgtcggtggtgcgcaggctgccgcgcattaaagagatgcaaagt
atgtttgttttgaaagagattaaaccgctgacatctttccccgttaaaaatctgggttga

DBGET integrated database retrieval system