KEGG   Pantoea ananatis AJ13355: PAJ_1728
Entry
PAJ_1728          CDS       T01969                                 

Gene name
yahN
Definition
(GenBank) lysine exporter protein YahN
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: LysE
Other DBs
NCBI-ProteinID: BAK11808
UniProt: A0A0H3KXK1
Position
2091099..2091725
AA seq 208 aa
MSLHTELLPYILALGLAAAIPGPGMTTIVARSINGGSLAGFAALIGVIMGDVFYLTLAVF
GLGIVAKTYTALFTLINWAAALYLGYLAWQFWSYQPRAISIDQKVTRQQLVSAWLSGLSI
TLGNPKTIAFYLAILPLVISLEAISLKFWGAVLVPVTAAVLLAVGAMFILAAVKVRVFLT
RPRSLRIMYRVVGVMMLLAAMGMIVKTL
NT seq 627 nt   +upstreamnt  +downstreamnt
atgtcgcttcatactgaattactgccttatattttggcgctgggactggccgccgcgatt
ccgggccccgggatgacgacgatcgttgcgcgtagcatcaatgggggttccctggcaggc
tttgctgcgcttatcggcgtgataatgggcgatgtgttttatttaaccctggccgtattt
ggtctgggcattgtggccaagacctacaccgcgctctttacgttgattaactgggcggcg
gcgctttatttgggctatctggcctggcagttctggtcttatcaaccccgtgctatcagc
attgaccagaaggttacccgtcagcaactggtctccgcctggctgtcggggctgagtatt
acgctgggcaaccccaaaacgattgccttttatctggcaatactgccgctcgttatttcc
ctggaggcaatttcactgaaattctggggtgccgtactggttcccgttaccgctgccgta
ttactggccgtgggcgcgatgtttattttggcggcggtgaaagtccgcgtgtttctgacc
cgcccgcgctcgctgcggatcatgtaccgggtcgtgggcgtgatgatgctgctggccgcc
atgggtatgattgttaaaacgctgtaa

DBGET integrated database retrieval system