KEGG   Pantoea ananatis AJ13355: PAJ_1729
Entry
PAJ_1729          CDS       T01969                                 

Gene name
ycdC
Definition
(GenBank) putative HTH-type transcriptional regulator YcdC
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: TetR_C_29 TetR_N TetR_C_4 TetR_C_21 TetR_C_24 TetR_C_15
Other DBs
NCBI-ProteinID: BAK11809
UniProt: A0A0H3KX97
Position
2091904..2092542
AA seq 212 aa
MTDTTKRKNDPEGLKKRILAGALKIFAEFGMQGARLEQIAESAQTTKRMVVYHFGNKEQL
YIDVLEQVYQQIREHETGLNLAAMEPGKAITKLVEASFDYHVSHPDFIRLICMENLSRGR
YISQSVRLSQLNRSALDLLDDILTRGQQQGLFIQPLDTLDVHRLISSICVHQVSNRFTFN
TLFSPDKSEEDIISRNRQLAVTATLRYICRHQ
NT seq 639 nt   +upstreamnt  +downstreamnt
atgacggacacgacaaaacgcaaaaacgatcctgaagggcttaaaaaacgcattctggct
ggcgcactcaaaatctttgctgagttcggcatgcagggcgcccggctggagcagatcgcc
gagagtgctcagacgacgaaacgcatggtggtctatcactttggcaataaagagcagctc
tatattgatgtgctggagcaggtttatcagcagatcagggaacatgaaaccggcctgaat
ctggcggcaatggaacccggaaaggccattacgaaactggttgaggccagcttcgattat
cacgtttcgcatcctgattttattcggctgatctgcatggagaacctctctcgcggacgc
tacatctcacaatccgtgcggctgagccagcttaaccgcagcgcgctggatctgctggat
gacatcctgacgcgcggtcaacagcaggggctgtttattcagccgctggacacgctggat
gtacatcgccttatcagtagtatctgcgtacatcaggtttctaaccggttcacgtttaat
acgctgttcagtccggacaaaagtgaagaggatattatcagccgcaatcgccagttagcg
gtgacggccacgctgcgttatatctgtcggcatcagtag

DBGET integrated database retrieval system