KEGG   Pantoea ananatis AJ13355: PAJ_1730
Entry
PAJ_1730          CDS       T01969                                 

Gene name
alo1
Definition
(GenBank) D-arabinono-1,4-lactone oxidase Alo1
  KO
K05888  L-gulono-1,4-lactone dehydrogenase [EC:1.1.2.-]
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PAJ_1730 (alo1)
Enzymes [BR:paj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.2  With a cytochrome as acceptor
    1.1.2.-  
     PAJ_1730 (alo1)
SSDB
Motif
Pfam: ALO FAD_binding_4
Other DBs
NCBI-ProteinID: BAK11810
UniProt: A0A0H3L1S2
Position
2092820..2094013
AA seq 397 aa
MLAVHPDDLLLDLSALSGLIRSDAHSVTFAGATPLEQIYSTLTEMDRMLASSPGVISVQT
LAGAMATGTHGQGLHQSSIADEAEHIRMVLSDGSVRELSRGDADFPAALVSLGVLGIVTE
VTLRTQPFRIFTCHKNAVSADSLESDLLRWNDEYELSKAWWFVDDNFIHVWNAHQASEEE
SHHYAQNDREVVEHADEGDDSLNDTIDQTLEHMHRDTQIHGKGGKQFRTVTRFRDFTDVT
GDIYQLFCRGIAVPQINVEIGVPLEKTPAVISKIKRWYADNRPHMHYPIILRCTGASSAW
LSPAFDQPTCFFGFVVYYADDGSLSEAGLHFLSEVEKLLAEEGGRPHWGKYYDASLYRWQ
DLYPHWASFRALREQFDPQGRLSNDYTAALFNQFDKG
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgctggccgtgcaccccgatgatttgctgctggatctgagtgcactgtccggcctgatc
cgcagtgatgcacacagcgtcacgttcgccggcgcgaccccgctggaacaaatctacagt
accttaacggaaatggatcgtatgctcgcctcctcacccggcgtgatttcggttcagacg
ctggctggcgcgatggctaccggcactcacggtcagggcctgcaccagagttccattgcc
gatgaggctgagcacattcgcatggtgctgagcgacggctcggtccgtgagctgtcacgt
ggcgatgcagattttcctgccgcactggtgtcgctgggcgtgctgggtattgtgaccgaa
gtgaccctgcgcacgcagccgtttcgtattttcacctgccataaaaatgcggtgtcggcg
gacagcctggaaagtgatttgctgcgctggaatgatgaatacgaactcagcaaagcctgg
tggtttgtggatgacaattttatccacgtctggaatgcacatcaggccagcgaggaggag
agccaccattatgcgcagaacgatcgtgaggtggtggaacacgccgatgaaggcgacgac
agcctcaacgacacgatcgatcagacgctggaacacatgcatcgcgacacccaaattcac
ggcaagggcggcaaacagttccgtaccgtaacgcgctttcgggattttaccgatgtgaca
ggcgacatctatcagctgttctgtcgcggtatcgccgtgccgcagatcaacgtcgaaatt
ggcgtaccgctggaaaaaacgccagcagtcatcagcaagattaaacgctggtacgccgac
aatcgcccgcatatgcactatcccatcatcctgcgttgtacaggtgcgtcatcggcatgg
ctcagcccggcctttgaccagcccacctgcttctttggctttgtggtgtattacgccgac
gacggctccctttcagaagcgggcctgcactttttaagtgaggtggagaagcttctggca
gaagaaggcggtcgccctcactggggcaagtattacgacgcctcgctgtaccgctggcag
gatctctacccgcactgggcgtccttccgtgctctgcgtgagcagttcgatccgcaaggc
cgtctgagcaacgactacaccgctgcactgtttaatcaattcgataagggatga

DBGET integrated database retrieval system