KEGG   Pantoea ananatis AJ13355: PAJ_1731
Entry
PAJ_1731          CDS       T01969                                 

Definition
(GenBank) glycosyl transferase family protein
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: Glyco_transf_8 Mannosyl_trans3 Nucleotid_trans Glyco_transf_24
Other DBs
NCBI-ProteinID: BAK11811
UniProt: A0A0H3KXN4
Position
2094015..2094842
AA seq 275 aa
MFAWVTLLTQPDYLVGVKALRRSLTQSQTRWPLVVMATAAIDEQDCAILEEEGCIIQHVE
GLYPHSDLNPQYASERFGEVWTKLRAWQLTDYQRVVFLDADMLVLQNMDELFSLDLGGHA
LAACHACRCNPNQIEAYPDSWQPEFCHYTWQEREESPPAHVDYYLNGGFLVLEPDNAVFE
KLEARIAAIEDLSQYAFSEQDLLNEAFKGQWLPLSYVYNALKTLRFQHDKLWECEEVKNL
HYILDKPWQRDLSQPVSQRDRYYAMDKLWWDKVSA
NT seq 828 nt   +upstreamnt  +downstreamnt
atgtttgcctgggtaaccttactgacgcaaccggattatctggtcggcgtaaaagcgctg
cgccgttcactcactcaaagtcaaacgcgttggcccctggtcgtgatggcaaccgctgcc
attgatgagcaagactgcgcgatcctggaagaggaaggctgcataatccaacatgtggag
gggctttatccgcacagcgatttgaacccgcagtatgcatctgaacgttttggtgaagtc
tggaccaaactgcgcgcctggcagttgaccgattatcagcgggtggtctttctggatgcc
gatatgctggtacttcagaacatggatgagctgttctcgctggatctgggtggccatgcg
ctggccgcctgccacgcctgccgctgcaatccgaatcagatcgaggcctatcccgacagc
tggcagcccgagttctgccactacacctggcaggaacgtgaggagtcgccgcccgcacat
gtggattattacctcaacggcggctttctggtgctggagcctgataacgccgtttttgaa
aaacttgaagcgcgcattgccgctatagaggacctgagccagtacgccttttcagagcag
gatttgctgaacgaggcttttaaaggccagtggctgccgctctcctatgtctacaatgcc
ctaaaaacgctgcgtttccagcacgataagctgtgggaatgtgaagaggtgaagaacctg
cattacattctggataagccgtggcagcgcgatttgtctcagcctgttagtcagcgtgat
cgctattatgcgatggataaactgtggtgggataaagtctcagcctga

DBGET integrated database retrieval system