KEGG   Pantoea ananatis AJ13355: PAJ_1732
Entry
PAJ_1732          CDS       T01969                                 

Gene name
yjhC
Definition
(GenBank) oxidoreductase YjhC
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: GFO_IDH_MocA_C GFO_IDH_MocA NAD_binding_3 Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: BAK11812
UniProt: A0A0H3L4Q0
Position
complement(2094922..2096043)
AA seq 373 aa
MNKVRIGMIGSGYIGRCHAIAYAQAPAVFALKGEIVREMLAEVNPELAAKQAATFGFSRS
TGNWRELVSDPNIDVVDICAPNFLHKEMALAAIANGKHVYSEKPLSLTVADAREMVEAAN
RAGIKTLVGFNYMKNPTSQLAKEIIARGEIGEVVHFYGTHNEDYLAKPETPLDWHCQKAL
AGLGALGDLAAHIVNMAHYLVGNIAEVSGDMMTVITTRPDPKDLSRQLPVENEDQASALL
RFHNGAHGVIETSRIACGAKMGLTYVVTGTKGTLRYTQERMAELELYIHDEPTGRQGFKT
LLTGPAHPDYANFCVSAGHGIGFNDQKTVEMRDLINGIAAGDPMWPDFAEGLQVQKVLEA
IALSAAERRWMAV
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgaacaaagtcagaatcggcatgatcggtagcggctatatcggtcgttgccacgcgatt
gcctatgcccaggcacccgcggtgtttgcgttaaaaggggagatcgtgcgtgaaatgctg
gcagaggttaatcccgaactggccgcaaagcaggctgccacctttggtttttcccgctct
acgggcaactggcgcgagctggtgagcgacccgaatattgatgttgtggacatctgcgcg
cccaatttcctgcataaagagatggcgctggccgccattgctaacggcaaacacgtgtat
tccgagaagccgttatccctgacggtggccgatgcgcgggaaatggttgaagcggccaat
agagcagggattaaaaccctggtgggcttcaactatatgaagaatccgaccagtcagctg
gcaaaagagatcatcgcgcgcggtgaaattggcgaggtggtgcacttttacggcacgcac
aacgaagactatctggcgaaaccggaaacgccactcgactggcactgtcagaaagcgctg
gccgggttaggtgcgctgggcgatctggcggcgcacatcgtcaatatggcgcactacctg
gtgggcaatattgcggaagtcagtggggatatgatgacggtgattaccacccgtcctgac
ccaaaggatctcagccgtcagttgccggttgaaaatgaagatcaggccagcgccttgctg
cgctttcacaacggtgcgcacggtgtgattgaaacctcgcgtatcgcctgtggggctaaa
atggggttgacctatgtcgtgaccggcaccaaaggtaccctgcgttacactcaggagcgc
atggccgagctggaactgtatatccatgatgaaccgacggggcggcagggctttaaaacc
ctgctgaccgggcctgcgcatccggactatgctaacttctgcgtctctgcaggtcatggt
attggctttaacgatcagaaaacggtagaaatgcgcgatctcattaatggcattgccgct
ggcgaccctatgtggcctgattttgcagaaggattgcaggtgcagaaggtgcttgaggcc
atcgcgctgtcggcggcagaaaggcgctggatggcggtatag

DBGET integrated database retrieval system