KEGG   Pantoea ananatis AJ13355: PAJ_1733
Entry
PAJ_1733          CDS       T01969                                 

Gene name
yiiL
Definition
(GenBank) cytoplasmic protein YiiL
  KO
K03534  L-rhamnose mutarotase [EC:5.1.3.32]
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PAJ_1733 (yiiL)
Enzymes [BR:paj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.32  L-rhamnose mutarotase
     PAJ_1733 (yiiL)
SSDB
Motif
Pfam: rhaM
Other DBs
NCBI-ProteinID: BAK11813
UniProt: A0A0H3KXK7
Position
complement(2097906..2098235)
AA seq 109 aa
MRSAAMLRKAFVMQVHAHCHDEYLRRHSPIWPELEQTLKAHGAHHYAIWLDADRNLLFAS
VEIESEARWLAVAQTEVCQRWWASMKDLMPSNADNSPISAELKPMFFLP
NT seq 330 nt   +upstreamnt  +downstreamnt
atgcggagcgcagcgatgttacgtaaagcttttgtcatgcaggtgcatgctcactgccac
gatgaatacctgcgtcgccattcacccatctggccggaactggaacagacgctaaaagcg
catggtgcccatcactatgctatctggctggatgccgatcgtaacctgctgttcgccagc
gttgaaattgaatcagaagcccgctggctcgcggtggcgcaaaccgaggtttgccagcgc
tggtgggcatcgatgaaagatttaatgccgtctaatgcggataacagcccgataagtgca
gagctcaaaccgatgttttttctgccttag

DBGET integrated database retrieval system