KEGG   Pantoea ananatis AJ13355: PAJ_1734
Entry
PAJ_1734          CDS       T01969                                 

Gene name
rhaD
Definition
(GenBank) rhamnulose-1-phosphate aldolase RhaD
  KO
K01629  rhamnulose-1-phosphate aldolase [EC:4.1.2.19]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00040  Pentose and glucuronate interconversions
paj00051  Fructose and mannose metabolism
paj01100  Metabolic pathways
paj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PAJ_1734 (rhaD)
   00051 Fructose and mannose metabolism
    PAJ_1734 (rhaD)
Enzymes [BR:paj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.19  rhamnulose-1-phosphate aldolase
     PAJ_1734 (rhaD)
SSDB
Motif
Pfam: Aldolase_II
Other DBs
NCBI-ProteinID: BAK11814
UniProt: A0A0H3KXA2
Position
complement(2098210..2099052)
AA seq 280 aa
MQNILTSWFVQGMVKATSDMWLKGWDERNGGNVSLRLLPEEVQDFASDFYAEPRCIELSK
PAPALANDWFLVTGSGKFFRNVQLDPADSLVLLQVDDQGLSYKIHWGLSNGGLPTSELAA
HFQSHSVRKQVTHGSDRVIMHCHATHFMALSYVVNLDSARFTRLLWEGSTECLVVFPDGV
GILPWMVPGTDGIGQATADEMAIHSLVMWPFHGIFGAGPNLDETFGLIDTAEKSSEVVVK
ALSMGGIRQSITTAQLIALGERFNVKPWQAALDAERSDVT
NT seq 843 nt   +upstreamnt  +downstreamnt
atgcaaaacattctgacatcctggttcgtacaggggatggtaaaagccaccagcgatatg
tggttgaaaggctgggatgagcgtaacggcggtaacgttagcctgcgcctgcttcccgaa
gaagtgcaggacttcgccagcgacttttatgccgaaccgcgctgcattgaactgagtaaa
ccggctccggcgttagctaacgactggtttttagtgaccgggtccggcaagttttttcgt
aacgtgcagctcgacccggcagacagcctggtgctgctgcaggtggatgaccaggggttg
tcgtataaaattcactggggattaagcaacggtgggctcccgacctctgaactggcggcg
catttccagtcgcacagcgtacgcaagcaggtgactcatggaagcgatcgggtgattatg
cactgccatgctactcactttatggcgctgagctacgttgtaaatctggattcggcacgc
ttcacgcgcctgctttgggaaggcagcacagagtgtctggtggtgttcccggacggggtg
ggcattttgccatggatggtgccgggcactgacggtatcggccaggctacggctgatgag
atggcgatccacagcctggtcatgtggcccttccacggcatctttggcgcgggtcctaat
cttgatgagacctttggcctgatcgacaccgctgaaaaatcatcggaggttgtcgtaaaa
gccctatctatgggcggtattcgtcagagcatcaccaccgcgcagctgatcgcgctgggt
gaacgctttaacgttaaaccctggcaggcagcactggatgcggagcgcagcgatgttacg
taa

DBGET integrated database retrieval system