KEGG   Pantoea ananatis AJ13355: PAJ_1735
Entry
PAJ_1735          CDS       T01969                                 

Gene name
rhaA
Definition
(GenBank) L-rhamnose isomerase RhaA
  KO
K01813  L-rhamnose isomerase [EC:5.3.1.14]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00051  Fructose and mannose metabolism
paj01100  Metabolic pathways
paj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PAJ_1735 (rhaA)
Enzymes [BR:paj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.14  L-rhamnose isomerase
     PAJ_1735 (rhaA)
SSDB
Motif
Pfam: RhaA
Other DBs
NCBI-ProteinID: BAK11815
UniProt: A0A0H3L1S8
Position
complement(2099063..2100319)
AA seq 418 aa
MTKLIEQAFDLAKQRYAENGVDVDLVMAQLDEIPVSMHCWQGDDVRGFENPNGQLTGGIQ
ATGNYPGRARNADELRADIEKAISLIPGALRLNLHAIYLESSQPVERDAIEPKHFSNWVA
WAKSNRLGLDFNPTCFSHAKSADGFTLSHADSGIRQFWIDHCKASRHISAYFGEQLGTPS
VMNIWVPDGMKDLTIDRFAPRQRLASALDAIISEQLNPQHHIDAVESKLFGIGAESYTVG
SNEFCLGYASSRQIALTLDAGHFHPTEVISDKISTAMLYVPRLLLHVSRPVRWDSDHVVL
LDDETQAIAHEIARQKLFDKVHIGLDFFDASINRIAAWVIGTRNAKKALLRALLEPSDRL
RRLESEGDFTARLALLEEQKSLPWQAVWEAWCLRHDVPADASWLSDVRHYEQHTLRQR
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgacaaagctgattgaacaggcctttgacctggcgaaacaacgttatgctgagaatggc
gttgatgtggaccttgtgatggcgcaactggatgagatcccggtctcgatgcactgttgg
cagggtgatgacgtgcgcggttttgaaaatcccaacgggcaactcaccggcggtattcag
gccaccggcaactatccgggacgggcacgcaacgccgacgaattgcgcgccgacattgaa
aaagccatatcgctgattccgggcgccttacgtctgaatctgcacgcgatctatcttgaa
agcagccaacccgttgagcgcgatgccatcgagccgaaacacttcagcaactgggtagcg
tgggcaaaaagcaacaggctggggctggatttcaatcccacctgcttttcacatgcaaag
agtgccgatggctttacgctgtcgcacgccgattcaggtattcgccagttttggatcgac
cactgtaaagccagtcgccatatttcggcttactttggtgagcagctcggtacgccttcc
gtgatgaacatttgggtgccggacggcatgaaagatctcaccatcgaccgctttgcgccg
cgccagcgccttgccagcgcgcttgacgcgatcatcagtgagcaactcaacccgcaacac
catattgatgctgtggaaagcaaactattcgggattggtgcggaaagctacaccgtgggt
tccaacgaattctgccttggctacgccagcagccggcagattgcgctgacgctggacgcc
gggcatttccacccgactgaagtgatctccgacaaaatctctaccgcgatgctgtacgtg
ccgcgcctgctgctgcatgtgagccgtccggtacgttgggacagcgatcatgtagtgctg
ctcgatgatgaaacccaggcgattgcccatgagatcgcccgccagaaactcttcgataag
gtgcatatcggcctcgacttttttgatgcctcaatcaaccgcattgccgcctgggtcatt
ggtacgcgtaacgccaaaaaagcgttgctgcgggcgctgctggagcccagcgatcggctg
cgtaggctggagagtgaaggggatttcaccgcacggttggccctgctggaagagcaaaag
tcgctgccgtggcaggcggtgtgggaagcatggtgcctgcgccatgacgttcctgccgat
gccagctggctgagcgacgtccgtcattacgaacaacatactttgcgtcaacgttaa

DBGET integrated database retrieval system