KEGG   Pantoea ananatis AJ13355: PAJ_1736
Entry
PAJ_1736          CDS       T01969                                 

Gene name
rhaB
Definition
(GenBank) rhamnulokinase RhaB
  KO
K00848  rhamnulokinase [EC:2.7.1.5]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00040  Pentose and glucuronate interconversions
paj00051  Fructose and mannose metabolism
paj01100  Metabolic pathways
paj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PAJ_1736 (rhaB)
   00051 Fructose and mannose metabolism
    PAJ_1736 (rhaB)
Enzymes [BR:paj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.5  rhamnulokinase
     PAJ_1736 (rhaB)
SSDB
Motif
Pfam: FGGY_N FGGY_C
Other DBs
NCBI-ProteinID: BAK11816
UniProt: A0A0H3KXN9
Position
complement(2100303..2101784)
AA seq 493 aa
MNMRNIVAIDLGASSGRVMLAQWTSDSQKIALREVRRFANQRVQRGGYDCWDLDRLEQDI
RAGLQQLDDEGIVPDSMGIDTWGVDLVLLDADGHRVGEAVSYRDKRSEGLMARAIDDLGQ
QAIYQRTGIQFLPFNTLYQLRALHLQQPDWQARVQHALMIPDYLHYRLTGEMNWEYTNAT
TTQLLNIQSGDWDRDLLDWAGVDSAWFGTPHAPGNNVGYWASASGKRIPVIAVATHDTAS
AVLATPLMHDDAAYLSSGTWSLMGIESLQPYVNATALQANITNEGGAEGYRVLKNIMGLW
LLQRVCSELNIRDLPLLIADAAKQPACRSLIDPNHPRFINPDNMVQAIQHACAEQAMPIP
HTAAALARTLFDSLALSYRQTMLELGQLRGTPLRQLHIVGGGSQNPLLNQLCADACQLPV
VAGPVEASTLGNVGCQLIALGELRDVADLRRCISRNFPSDIFEPLDNSAFAAHQARFTAL
LQPAKELAYDKAD
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgaatatgcgtaacatcgttgccattgatttaggcgcatccagcgggcgcgtcatgctt
gcgcagtggacgtcggacagccagaaaatcgccctgcgtgaagtacgtcgtttcgcgaat
cagcgggttcagcgcggcggctatgactgctgggatctggatcgtctggagcaggacatt
cgcgccggactgcagcaactggatgatgaaggcatcgtgccggacagcatgggtattgat
acctggggcgttgatttggtactgctggatgcagacggacatcgcgttggcgaagccgtg
agctaccgtgacaaacgcagcgagggcctgatggcccgggcgattgacgatctcggccag
caggcgatataccagcgcaccggcattcagtttctgccatttaacaccctatatcagctg
cgcgcgctgcatctgcagcagccggactggcaggcgcgggtgcaacatgcgctgatgatt
ccggactatctgcactatcgcctcaccggcgaaatgaactgggaatacaccaacgccacc
accacgcagttactgaatattcaaagtggtgactgggatcgtgacttgctggactgggct
ggtgtcgattccgcctggttcggcacaccgcatgcaccgggcaataacgtgggttattgg
gccagcgccagcggcaagcggatcccggtgattgccgtagccacgcacgatacggccagc
gcggtgctggccacgccactgatgcacgacgatgcagcctatctcagttcaggtacctgg
tcgctaatggggattgaaagtctccaaccctatgtgaatgcgactgctttacaggccaac
ataaccaatgaaggcggcgcggaaggttaccgggtgctgaaaaacattatggggctatgg
cttttacagcgcgtctgtagcgaactgaacatccgcgacttgcccctgcttattgcggat
gccgcaaagcagccagcctgccgctcgctcattgatcctaaccaccctcgctttattaac
ccagacaacatggtgcaggcaatccaacatgcctgtgctgaacaggcgatgccgataccg
cacactgcggccgcactggcacgcaccctctttgacagtctggcgctttcatatcggcag
acaatgctggaactcggccagctgcgcggcacaccgctacggcagctgcatatcgtgggc
ggcggcagccagaatcctttactcaaccagctgtgtgccgatgcctgccaactgccggtg
gttgccggtccggtagaagcctccacgctgggaaatgtgggttgccagctcatcgcgcta
ggtgaactgcgtgacgtcgcggatttgcgccgctgcatcagccgtaatttcccgtcagac
atctttgaaccgctcgacaacagcgcgtttgcggcccatcaggcgcgcttcaccgcgctg
ctccaacctgctaaggaacttgcatatgacaaagctgattga

DBGET integrated database retrieval system