KEGG   Pantoea ananatis AJ13355: PAJ_1738
Entry
PAJ_1738          CDS       T01969                                 

Gene name
rhaR
Definition
(GenBank) HTH-type transcriptional activator RhaR
  KO
K02854  AraC family transcriptional regulator, L-rhamnose operon transcriptional activator RhaR
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:paj03000]
    PAJ_1738 (rhaR)
Transcription factors [BR:paj03000]
 Prokaryotic type
  Helix-turn-helix
   AraC family
    PAJ_1738 (rhaR)
SSDB
Motif
Pfam: HTH_18 HTH_AraC AraC_binding Cupin_2 Scramblase
Other DBs
NCBI-ProteinID: BAK11818
UniProt: A0A0H3KXL2
Position
2102909..2103775
AA seq 288 aa
MSLILSREDYFPARNLPIAVAERMPQPSFPPHQHRFSEIVIVWRGNGLHILNDRPWLITC
GDVFYIHDSDCHSYDSVHDLALDNILYCRDRFRLDLDWSQLIPPQEENAQSGWRLTTQGM
ALARGVISQLERESRKNDPLSIQLSEALFLQLALILRRHGYAADRSWALPEGEQLDLLMS
SLLADISRPFDLAHFCEQHQLSERALKQLFRQQTGMTIGHYLRQLQLCQAKYLLRTQESL
ISEIASRCGFDDSNYFSVVFTRETGMTPSAWRQRFVPQCATLTDNAKA
NT seq 867 nt   +upstreamnt  +downstreamnt
atgtcgctaattctgtcgcgcgaggactactttcctgccagaaacctgcccattgcagtg
gccgaacgtatgccacaaccctctttcccgcctcatcaacacaggtttagcgagattgta
attgtctggcgcggcaacgggctgcacatcctcaacgatcgcccctggctgattacctgc
ggcgatgtgttttatattcacgacagcgactgccatagctatgacagcgttcatgacctg
gcgctcgacaacattctttattgccgcgatcgctttcggctcgatcttgactggagccag
cttataccgcctcaggaagagaatgctcagtccggttggcgattaaccacccagggtatg
gcgctggcgcgtggcgtcatcagccaactggagcgggaaagccgcaaaaacgatcccttg
tccattcagctttctgaagccttgtttttacagctggcgctgattctgcgccgccacggt
tacgcggccgatcgttcctgggcgctaccggaaggcgaacagcttgatctgctgatgtcg
tcgctgctggccgatatcagccgtccgtttgacctcgcccacttttgcgagcagcaccaa
ctcagcgagcgagcgcttaaacagctgtttcgccagcaaaccggcatgacaattggccac
tatttgcgtcagcttcaactctgtcaggcaaaatacttactgcgcacccaggaaagttta
atcagcgagattgcttcacgctgcggctttgatgacagtaactatttttcggtggtgttt
acgcgtgaaaccggcatgacgcccagtgcctggcggcaacgttttgtaccgcaatgcgcc
acgctaactgataacgcaaaagcctga

DBGET integrated database retrieval system