KEGG   Pantoea ananatis AJ13355: PAJ_1739
Entry
PAJ_1739          CDS       T01969                                 

Gene name
rhaT
Definition
(GenBank) L-rhamnose-proton symporter RhaT
  KO
K02856  L-rhamnose-H+ transport protein
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paj02000]
    PAJ_1739 (rhaT)
Transporters [BR:paj02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   PAJ_1739 (rhaT)
SSDB
Motif
Pfam: RhaT
Other DBs
NCBI-ProteinID: BAK11819
UniProt: A0A0H3KXA7
Position
complement(2103812..2104846)
AA seq 344 aa
MNSAIIAGIFWHLVGAASAACFYAPFKQVKKWSWETMWAVGGLMSWLILPWAVSAVLLPN
FWAYYSSFSLSQLLPVFLFGAMWGIGNINYGLTMRYLGMSLGIGIAIGITLVVGTLMTPL
LQGRFVALFSSAGGRMTLLGVLVALIGVAIVSRAGLLKERALGINAEEFNLKKGLILAVI
CGIFSAGMSFAMDAAKPMHVAAANLGINPLYVALPSYVVIMGGGALINLAYCFIRLAVKP
ELSLRRDFSVAKPLLIANIAFAILGGTMWYLQFFFYAWGHAKIPPQYDFVSWMLHMSLYV
LCGGLVGLMLKEWKSVGRRPVSVLSIGCIVIIIAANIVGLGMAA
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgaacagtgccattattgccggtattttctggcatctggtgggtgccgccagtgccgca
tgtttttatgcgccgtttaaacaggtcaaaaaatggtcatgggaaaccatgtgggcagta
ggtggcttgatgtcgtggctgattttgccatgggcagtcagtgccgtactgctgccgaat
ttctgggcgtactacagtagtttcagtctgtcacagctgctacctgtgtttttgtttggt
gcaatgtggggcatcggcaatattaactacggcctgaccatgcgctatctcggcatgtcg
ttaggcatcggtattgctatcggcattacgttagtcgtcgggacactcatgacgccgttg
ctgcagggccgttttgtcgcgctctttagctcggctggtggccgtatgacgctgcttggc
gttctggtcgcgctgattggcgtggcaattgtatcgcgagcaggtttgctgaaagagcgc
gcgctgggcattaacgccgaagaattcaatctgaagaaagggctgatactggcggttatc
tgcggtattttctcagccggcatgtccttcgctatggatgccgcaaagccgatgcatgtt
gcggcagctaatctgggtattaatccgctgtacgtggcgctacccagctatgtggtgatt
atgggcggtggtgcgctgattaacctggcgtactgctttatccgcctggcggttaagccg
gagctctccctccgccgggacttctccgtggcaaaaccgctgttaattgccaatatcgct
ttcgctattcttggcggcaccatgtggtatctgcagttctttttctatgcatggggccat
gccaaaattccaccgcaatatgactttgtcagttggatgctgcacatgagtctgtatgtg
ctgtgtggtggtctggtcggactgatgctgaaagagtggaaatctgtcgggcgtcgtccg
gttagcgtcctgtcgattggctgcatagtcattatcatcgctgccaatattgtcgggctt
ggcatggctgcctga

DBGET integrated database retrieval system