KEGG   Pantoea ananatis AJ13355: PAJ_1740Help
Entry
PAJ_1740          CDS       T01969                                 

Gene name
aldA
Definition
(GenBank) aldehyde dehydrogenase A AldA
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00620  Pyruvate metabolism
paj00630  Glyoxylate and dicarboxylate metabolism
paj01100  Metabolic pathways
paj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PAJ_1740 (aldA)
   00630 Glyoxylate and dicarboxylate metabolism
    PAJ_1740 (aldA)
Enzymes [BR:paj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     PAJ_1740 (aldA)
    1.2.1.22  lactaldehyde dehydrogenase
     PAJ_1740 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 OmdA
Motif
Other DBs
NCBI-ProteinID: BAK11820
UniProt: A0A0H3L1T3
Position
2105677..2107110
Genome map
AA seq 477 aa AA seqDB search
MTTHHQHFINGVFVPNHNEKWIEVINPATEALLSRIPQGTRQDAADAIAAADAAQPGWEA
LPAVERGSWLRKIATAIRQREPELSATIVAEGGKTQGLAKTEVLFTADYLDYMSEWARRY
EGEIVNSDRPNENIFVFKKAIGVTTGILPWNFPFFLIARKAAPALITGNTIAIKPSELTP
NNAALFAQIVADIGLPKGVFNVVYGYGPEIGQELAGNEKVGLVSLTGSVNAGIAAMEAAA
KNVTKVSLELGGKAPAIVMDDADLDLAVKAIVSSRVINTGQVCNCAERVYVQEGIYDRFI
SALTEAMQHVTFGNPAEKNDIDMGPLITAAALARVEQKVARAVEEGGRVVLGGKRAGREG
FYFEPTIITGVRQEMEIMREEIFGPVLPVMTFKTLEEAIALANDCEYGLTSSIYTQNLTT
TMTALRQLKFGETYVNRENFEAMQGFHAGWRKSGIGGADGRHGLEEYLQTHVVYLQC
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacatcatcaacatttcattaatggtgtttttgtgcctaatcacaacgaaaag
tggattgaagtgattaatcctgctaccgaagcgctactgtcacgcattcctcaaggcacg
cgtcaggacgccgcagacgctatcgccgctgccgatgccgcgcagccgggctgggaagcc
ttaccggccgtggagcgcggcagctggctgcgtaaaattgccacagccattcgtcagcgt
gaacccgaactcagcgccactatcgtggcagaaggcggtaaaacccaggggctggcaaaa
accgaagtgctttttactgctgattacctggactacatgtccgaatgggcgcgacgctac
gaaggtgagattgtgaacagcgatcgtcctaatgaaaatattttcgtctttaaaaaagcg
attggcgttactaccggcatcttaccgtggaacttcccgttttttttgattgcgcgtaaa
gcggcgccggcactgattaccggcaatacgattgcgataaaaccgagtgagttgacgccc
aataacgcggccctgtttgcacagatcgttgcggatatcggcctgccaaaaggtgtgttc
aatgttgtttacggctacggacctgagatcggtcaggagctggctggcaacgaaaaagtg
gggttggtaagcctgacgggcagcgttaatgccgggattgccgccatggaagcggcagca
aaaaacgttaccaaagtctctctggagctggggggtaaagcgccggccattgtaatggat
gatgccgacctcgatctggcagtaaaggccattgtcagctctcgcgtcattaatacaggt
caggtctgcaactgcgcagagcgggtttatgtacaggaagggatttatgaccgctttatc
agcgcactgacagaggcgatgcaacacgtgacgtttggcaatccggctgaaaaaaacgat
atcgatatggggccattgatcaccgccgccgcgctggcgcgggttgagcaaaaagttgcc
agggcagtagaagaaggcggcagggttgtgttgggcggtaaacgggcgggtcgcgagggc
ttttacttcgagcccacgattattaccggcgtacgccaagagatggagattatgcgtgag
gaaatttttggcccggtgcttcctgtaatgacctttaaaacgctcgaagaagctatcgca
ctggccaatgactgtgagtacggcctgacttcctcaatctacactcagaacctgaccacc
acaatgaccgccctgcgtcagctgaagtttggtgaaacctacgttaaccgcgagaatttt
gaagccatgcagggattccatgccggctggcgcaaatctggcatcggcggtgctgatggt
cgtcatgggctcgaggaatatctgcaaacgcatgttgtgtatttgcagtgttaa

DBGET integrated database retrieval system