KEGG   Pantoea ananatis AJ13355: PAJ_1741
Entry
PAJ_1741          CDS       T01969                                 

Gene name
yjiW
Definition
(GenBank) hypothetical protein YjiW
  KO
K19048  toxic protein SymE
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:paj02048]
    PAJ_1741 (yjiW)
Prokaryotic defense system [BR:paj02048]
 Toxin-antitoxin system (TA system)
  Type I TA system
   SymE-SymR
    PAJ_1741 (yjiW)
SSDB
Motif
Pfam: SymE_toxin
Other DBs
NCBI-ProteinID: BAK11821
UniProt: A0A0H3KXP5
Position
complement(2107330..2107551)
AA seq 73 aa
MSVTTLNLVQKPSSAISKTQRRYKVGYVPNFGDTSTPALNISGKWLREAGFDTGTRVSAE
ISEGCIVLRVDKS
NT seq 222 nt   +upstreamnt  +downstreamnt
atgtctgttaccacgcttaatcttgttcagaaaccgtcttccgcgatttcaaaaactcag
cgccggtacaaagtcggctacgtacctaattttggcgacaccagcacgcctgcgctgaat
atcagcggcaaatggttgcgtgaagccggatttgataccggcacgcgggtctcggcagaa
attagcgaaggatgcattgtgctgcgggtcgataagtcataa

DBGET integrated database retrieval system