KEGG   Pantoea ananatis AJ13355: PAJ_1742
Entry
PAJ_1742          CDS       T01969                                 

Definition
(GenBank) hypothetical protein
Organism
paj  Pantoea ananatis AJ13355
SSDB
Other DBs
NCBI-ProteinID: BAK11822
UniProt: A0A0H3L4R0
Position
complement(2107854..2108684)
AA seq 276 aa
MAFPGIHVIEGLTTNPSLNSDTSGSFLPSEILKESLILMSSLEPMEIASLSKRETSVIAS
ALNDYKNNSNSRFKNPPTEQATGRRPNGEIKHINNRILGIPVQHYNTTSMGAVALSSATL
LAIFWTSTAGLFSIVGRSIVPAVASLGGIGLSYHSNNRTLSINQLAAHLKNLADNFNSAH
DALVAFSQKAKLKKHNFKPSKDTEPTFAGEVISKNPIPAAHRERMSYILNQFTFTEYQRV
ELIGDSANFVKLFFNQNEQLTLTKIEYGYLTAMDIP
NT seq 831 nt   +upstreamnt  +downstreamnt
atggcatttccaggcatacatgtgattgagggactcacgacgaatcccagtttaaattct
gatacttcaggcagctttttaccctctgaaattctcaaagaatcattgattctgatgagt
tcgcttgagccgatggaaattgccagtctttctaaaagggaaaccagtgttattgccagt
gcgttgaacgattataaaaataacagtaacagtcgttttaaaaatcctcccacagagcag
gctacagggcggcggccgaatggtgagataaagcatattaacaatcgcatactcggcatt
cctgtacagcattataataccacttcaatgggagccgttgcgttaagttcagccacctta
ttggcaatcttttggacctcaactgcaggtttatttagcatcgttggacgaagtatcgtc
cctgctgtggcaagtcttggcggaattggtttatcgtaccattcaaataaccgcaccctg
tcaattaatcaattagctgcgcatttgaaaaatctggcagacaattttaacagcgcgcat
gatgcgctcgttgctttttctcagaaggcaaagttgaaaaaacataattttaaaccctcc
aaagacacagagccgacttttgcaggggaggtcatatctaaaaaccctattccagcagca
caccgtgaaagaatgtcgtatattttaaatcaatttacttttacagagtatcagcgcgtc
gagctcattggtgatagtgcgaattttgtgaagctgttttttaatcagaatgagcaattg
actttaacaaagattgaatatggctacctgactgcgatggacattccctaa

DBGET integrated database retrieval system