KEGG   Pantoea ananatis AJ13355: PAJ_1743
Entry
PAJ_1743          CDS       T01969                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAJ_1743
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paj02044]
    PAJ_1743
Secretion system [BR:paj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAJ_1743
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: BAK11823
UniProt: A0A0H3KXL7
Position
complement(2108720..2109202)
AA seq 160 aa
MAIDIFLKIDGIEGESQNANHKKWIDVLSFNWGAQQPGNMSVGGGGGAGKVNYRDLSVEA
LIDKATPALVKYCASGKHLPKIQLSVCKAGGQEVEYTRITLEDVLVTQTDFTGIGHASTL
GMQYSFQASKVALEYWEQASQGTKAASVQMGWDIKQNKES
NT seq 483 nt   +upstreamnt  +downstreamnt
atggctattgatatctttttgaaaatagatggaattgaaggtgagtcgcaaaatgcaaac
cataaaaaatggatagatgttctgtcatttaactggggcgcgcagcaaccaggtaatatg
tccgttggcggtggtggcggtgcgggaaaagtgaattatcgcgatttaagtgttgaggca
ttgatcgataaggccacaccggcgttagtgaaatattgtgccagtggtaagcatctgcca
aaaattcagctgtctgtttgcaaggcaggcgggcaggaagtggaatatactcgcatcacg
cttgaagatgtgctggttacgcagactgactttaccggcattggtcacgcgtccacgctg
ggtatgcagtattcctttcaagccagcaaggttgcgctggaatactgggaacaggcttct
cagggaacgaaagccgcttctgtgcagatgggttgggatatcaagcaaaataaagaaagc
taa

DBGET integrated database retrieval system