KEGG   Pantoea ananatis AJ13355: PAJ_1745
Entry
PAJ_1745          CDS       T01969                                 

Gene name
yhbW
Definition
(GenBank) monooxygenase YhbW
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: Bac_luciferase
Other DBs
NCBI-ProteinID: BAK11825
UniProt: A0A0H3L1T8
Position
complement(2110196..2111218)
AA seq 340 aa
MKKIGFLSFGHWTPSSQSATRSAQDVLLQSIDLAVAAEELGADGAYFRVHHFARQLSSPF
PLLAAVGARTKKIEIGTGVIDMRYENPLYMVEDASAADLISNGRLQLGLSRGSPEQVIEG
WRYFGYAPQEGETDADMGRRHTEVFLDALRGEGFAKPNPQPMFPNPPGLLRLEPLSEGLR
DRIWWGSGSNATSVWAAKMGMNLQSSTLKDDETGEPFHIQQAKQIRAYREAWKAAGHSRK
PRVSVSRSIFALVNDMDRAYFGRSGQDQDSVGFLDEKTRAIFGRSYAAEPEKLIKLLAED
EAIAEADTLLLTVPNQLGVDYNAHVIESILKYVAPELGWR
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgaaaaagattggttttctctcattcggccactggacgccatcatcgcagtccgccacg
cgttctgctcaggacgtgttgctgcagtctatagatttagcggtagcggcagaagaactc
ggggccgatggtgcctatttccgtgtgcatcacttcgcccgccaacttagctcgccgttc
ccactgctggcagcggtcggcgctcgcaccaaaaaaattgaaataggtactggcgttatc
gatatgcgctatgaaaatccgctctatatggtggaggatgccagcgctgccgatctgatt
tccaacggtcgcctgcagttgggcctgagccgcggctcgccagagcaggtgattgagggc
tggcgctattttggttatgcgccgcaggaaggcgagacggatgcggacatgggccgtcgc
cacacagaagttttcctggatgcgctgcgtggcgaaggttttgccaaaccgaatccacag
ccgatgttcccgaatccaccgggcctgctgcgtcttgagccgctgtctgaaggcctgcgc
gatcgcatctggtggggttcgggctccaacgccacgtcagtatgggcggcgaagatgggc
atgaacctgcaaagctcgacgctgaaagatgacgaaaccggcgagccgttccacatccag
caggcaaaacagatccgcgcctaccgtgaagcatggaaagcggcaggacactcgcgtaag
ccacgggtatccgtcagtcgcagtatttttgcgctggtgaacgatatggatcgggcttac
tttggccgcagtggacaggatcaggattcagtcggttttctggatgagaaaacccgtgcc
atctttggtcgcagctatgccgccgagccggaaaaactgatcaaactgttggcagaggat
gaggcgattgccgaagcggatacactgctgctcactgtaccgaatcagttgggcgtggac
tacaacgcacacgtcattgaatcgattctgaagtacgtggcgccggagctgggctggcgt
taa

DBGET integrated database retrieval system