KEGG   Pantoea ananatis AJ13355: PAJ_1746
Entry
PAJ_1746          CDS       T01969                                 

Gene name
apbA
Definition
(GenBank) putative 2-dehydropantoate 2-reductase ApbA
  KO
K00077  2-dehydropantoate 2-reductase [EC:1.1.1.169]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00770  Pantothenate and CoA biosynthesis
paj01100  Metabolic pathways
paj01110  Biosynthesis of secondary metabolites
Module
paj_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    PAJ_1746 (apbA)
Enzymes [BR:paj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.169  2-dehydropantoate 2-reductase
     PAJ_1746 (apbA)
SSDB
Motif
Pfam: ApbA ApbA_C F420_oxidored Pyr_redox_2
Other DBs
NCBI-ProteinID: BAK11826
UniProt: A0A0H3KXP9
Position
2111464..2112402
AA seq 312 aa
MRSMEEEGMRILIVGAGATGGYFGARLIQAGQNVTFLVREGRFNQLQQTGLVLQTRSGQE
TLEPQLVTAARLDAHYDLIILTVKSTGLAQAIHDIQPAVGPQTLIMPILNGMRHIDTLLT
HFGADRVIGGLCKINATLNDKGHVVQLTPLHQIYYGALDGNNDARLQQVDAALRGSAVET
FFSDNIIAELWEKWLLLSTLGAVCCLARGNTQQILTQAGGEMLLQGIYSEVLQVICAEGY
QPRPAVTAKIYELLNDPSTPMTSSMYRDLTQGFAIEADTIIGDLLRRASHHSMTVPLLNA
VNVNLQIYQQNR
NT seq 939 nt   +upstreamnt  +downstreamnt
atgcgttcaatggaggaagaagggatgcgtattttgattgtaggtgcgggggcaaccggc
ggctattttggcgcacggctgatacaggccgggcagaatgtcaccttcctggtccgtgaa
ggccgttttaatcagttacaacaaaccggcctggtgttgcaaacccgctcagggcaggaa
acgcttgaaccccagttggtcaccgccgccaggcttgacgcgcattacgacttaatcatc
ttaacggttaaaagtaccggcctggcgcaggcgattcacgacatccagccggctgtcggg
ccacaaaccctgatcatgccgattctgaatggcatgcggcatattgacaccttgctcacc
cacttcggtgccgatcgggtgatcggtggcttgtgcaaaatcaacgccacgttgaacgat
aaaggccatgtggtgcagttgacgcccttacaccagatctattacggcgcactggatggc
aacaacgatgcccgactgcagcaggtcgatgccgcgctacgtggtagtgccgtggaaacg
tttttttccgacaatattatcgctgagttatgggaaaaatggctgctgttaagcacgctc
ggcgcggtgtgttgtctggcgcgggggaatacgcaacagatactgacccaggccggtggc
gagatgctgcttcagggcatttacagtgaggtgcttcaggttatctgcgcggagggctat
cagccccgccctgccgttaccgcaaaaatttatgaattgctgaacgatccgtcgacgccg
atgacctcctccatgtatcgtgatttgacccagggttttgctattgaagccgatacgatc
attggcgacctgctacgacgagccagccatcatagtatgactgtgccactgttgaatgcg
gtgaatgttaacctgcaaatctatcaacagaaccgttaa

DBGET integrated database retrieval system