KEGG   Pantoea ananatis AJ13355: PAJ_1747
Entry
PAJ_1747          CDS       T01969                                 

Gene name
lacI
Definition
(GenBank) lactose operon repressor LacI
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: Peripla_BP_3 LacI Peripla_BP_1 Peripla_BP_4 HTH_10 HTH_AraC HTH_Crp_2 HTH_23 HTH_3 HTH_Tnp_ISL3 HTH_31 HTH_29 DUF3175 HTH_28
Other DBs
NCBI-ProteinID: BAK11827
UniProt: A0A0H3L4R4
Position
2112495..2113553
AA seq 352 aa
MTSRSVTLDDVAQLAGVSYQTVSRVLNRSEQVSPRTREKVEAAMQQLNYVPNRVAQQLAG
KATRTLGLATSNLALMAPAQIASAIQQRAASAGYHLVIAMDSEDNAEATVNELMAQRVDA
VLINMPLEAAEAEKIRVMCGKKPVLFLDADPHALVSHCQYSNEQGARAAVAHLIALGHRQ
IGLLNGPVRSVSARQREAVWRQALAEHQLSPCCVLRGDWSAKSGYQAMLAQLPNALPQAL
LVANDEMALGAMRALHQHGVAIPGDISLVGYDDTAESAWYQPPLTTIRQDLQQLGTHSVD
QVLAELRGEAVASRTLEPMLVIRETTAAPASQNLDLSDLARQLQQIARKLTR
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgacgtcccgctctgtgacccttgatgatgttgcccaactggctggcgtttcctatcaa
acggtttctcgcgtgcttaaccgctctgagcaggtttccccccgcacccgtgaaaaagtt
gaagcggcgatgcagcagcttaactatgtgcccaatcgggtcgcacagcagctggcggga
aaagcgacccgaaccttaggccttgcaaccagtaacctggccctgatggccccggcgcag
attgcttcggccattcagcagcgcgccgccagcgccggttatcacctggtgatcgcgatg
gacagtgaggataatgcggaagcgacagtgaatgaactgatggcccagcgcgtggatgcg
gtgctgatcaatatgccgttagaggcggccgaggcggaaaaaatccgcgtgatgtgcggt
aaaaagccggtgctgtttctggatgccgatccccatgctctcgtatctcattgccagtat
tcaaacgaacaaggggcgcgtgccgccgttgcacatctgattgcgctcgggcaccggcaa
attggcctgctgaatggcccggtgcgctcagtgtcggctcgtcagcgcgaagcggtctgg
cgtcaggcgctggcagagcatcagttatctccctgctgcgtcctgcgcggcgactggagc
gccaaatccggctatcaggcgatgctggcgcaactcccgaatgccctgccccaggcgctt
ttagtggcgaatgatgagatggcgctgggcgcgatgcgggcgctacatcagcacggcgtg
gcgattccgggcgatatttctcttgtcggctacgatgacacggcagaaagcgcctggtac
cagccgccactgaccaccattcgccaggatcttcagcagctcggcacccacagcgtggat
caggtgctggccgaactgcggggtgaagcggtggcgtcacgtaccctggagccgatgctg
gtgatcagagaaaccaccgcagcacccgccagccaaaacctggacttatcggatctggcg
cgtcaactccagcagattgcacgtaagctgacccgctaa

DBGET integrated database retrieval system