KEGG   Pantoea ananatis AJ13355: PAJ_1748
Entry
PAJ_1748          CDS       T01969                                 

Gene name
yeeX
Definition
(GenBank) alpha helix protein YeeX
  KO
K09802  uncharacterized protein
Organism
paj  Pantoea ananatis AJ13355
Brite
KEGG Orthology (KO) [BR:paj00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    PAJ_1748 (yeeX)
SSDB
Motif
Pfam: DUF496 ELP6
Other DBs
NCBI-ProteinID: BAK11828
UniProt: A0A0H3KXM5
Position
complement(2113652..2113978)
AA seq 108 aa
MENAKQSFQDVLEFVRTFRRKNKLQREIVDNEKKIRDNQKRVLLLDNLSEYIKPGMSVEA
IQEIIASMRADYEDRVDEYIIKNADLSKERRELSKKLKTMGVGETKAP
NT seq 327 nt   +upstreamnt  +downstreamnt
atggaaaatgccaagcaatcatttcaggacgtacttgagtttgtccgtacgtttcgccgc
aagaacaaactgcagcgtgaaattgtcgataatgagaagaaaattcgtgacaaccaaaag
cgtgttctgctgctggacaacctgagcgaatacattaaacccggcatgagcgtggaagcg
atacaggaaatcatcgccagcatgcgtgcggactatgaagatcgcgtggatgaatacatc
atcaaaaacgccgacctctcgaaagagcgccgtgagctgtctaaaaagctcaagaccatg
ggcgtgggtgaaaccaaagcgccgtaa

DBGET integrated database retrieval system