KEGG   Pantoea ananatis AJ13355: PAJ_1749
Entry
PAJ_1749          CDS       T01969                                 

Gene name
yeeA
Definition
(GenBank) inner membrane protein YeeA
Organism
paj  Pantoea ananatis AJ13355
SSDB
Motif
Pfam: FUSC_2 FUSC
Other DBs
NCBI-ProteinID: BAK11829
UniProt: A0A0H3KXB7
Position
complement(2114139..2115080)
AA seq 313 aa
MTGIPEGTWPLITLVVVMGPISTWGNVFPRAIQRIGGTIAGSISGLIALKLEMISLPGML
AWCALIMFISGYLTLGKHPYMALLIGITLCVVVGAPMGDFTVAMWRGGDVILGSLLALIF
TAVWAQRAYIHWRIQLSDTLGEMAKIYHAGFSANLVEKPRLNKPFGKLLSSVIKMRALLE
PSSKETRIPKSVFEAIQTINRNMVYTIEMQINAWWASRESHLIMLNAPTLRRTQQMTENA
LRTLSEMAVKGETYDIIAANHELTEIVNELKQLIASGSDRLEETPIYGYVWLSLELAKQL
ERMTDLLRLALRK
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaccggcattcccgaaggcacctggccgctgattacgctggtggtggtgatggggccg
atctccacgtggggcaatgtgtttccccgcgccattcagcgcattggcggcacgattgcc
gggtcaatttcgggattgattgcgctcaagctggagatgatttcgctaccgggcatgctg
gcctggtgcgcgctgatcatgtttatcagcggctatctgaccctgggaaagcatccctat
atggcgctgttgattggcattacgctctgcgtagtggtcggcgcgccaatgggggatttc
accgtcgccatgtggcgtggcggcgatgtgattttaggctcgctgctggcgctgatattt
accgctgtctgggcacagcgcgcctacattcactggcgtatccagctttcggatacgctg
ggcgagatggcaaaaatctatcatgcaggtttttccgctaacctggtggaaaagccgcga
ctgaataagccctttgggaagttgctctccagcgtcatcaaaatgcgcgcgctgttggag
ccgtccagcaaagaaacgcgtattcctaaatcggtatttgaagcgattcagaccataaac
cgtaatatggtgtacaccattgagatgcaaattaatgcctggtgggcatcgagggaaagc
catctgattatgctgaatgcgccgacgctgcgccgtactcagcagatgacggaaaacgcg
ctacgaacgttgtcggagatggcggtgaaaggggaaacctatgacatcatcgcggccaac
catgagttaacggaaatcgtcaatgaacttaagcagttgatcgccagcggcagtgaccgt
ctggaggaaacgccaatttatggctatgtctggttgagtctggagctggcgaagcaactg
gagcgcatgacggacttactgcgtctggcgctgcgtaaataa

DBGET integrated database retrieval system