KEGG   Pantoea ananatis AJ13355: PAJ_1750
Entry
PAJ_1750          CDS       T01969                                 

Gene name
dacD
Definition
(GenBank) penicillin-binding protein 6B precursor DacD
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00550  Peptidoglycan biosynthesis
paj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PAJ_1750 (dacD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:paj01002]
    PAJ_1750 (dacD)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:paj01011]
    PAJ_1750 (dacD)
Enzymes [BR:paj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PAJ_1750 (dacD)
Peptidases and inhibitors [BR:paj01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   PAJ_1750 (dacD)
Peptidoglycan biosynthesis and degradation proteins [BR:paj01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   PAJ_1750 (dacD)
SSDB
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Other DBs
NCBI-ProteinID: BAK11830
UniProt: A0A0H3L1U3
Position
complement(2115408..2116502)
AA seq 364 aa
MPFPVTPPAIDAASWVLMDATTGQVLTAGNPDERRNPASLTKLMTGYVVDRAIDQKKITR
DDMVTVGKDAWAAGNPVFKGSSLMFLKPGDKLSVRDLSRGVIIDSGNDACVALADYVAGS
QDNFVKLMNHYVEKLGLTNTHFETVHGLDAPGQFSSALDMAKLSRAIIDGEPDFYAMYRE
KTLTWNGITQNNRNGLLWDNSLHVDGLKTGHTETAGFNIIASNVVGQHRLIAVVMGGKSA
KGREEQARKLLVWGQNTFDTVQLFHAGKKIGSEHVWYGNPHQVEVGTANDVYLSLPRSEI
PNVKAKYVINRSDLEAPLKANENIGEIQVMDKDKQIASYPLVALSAVNEAGMFSRLSDYL
KRKF
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgccgtttcccgtgacgccaccggcgatcgatgccgcatcatgggtgctaatggatgcc
accacggggcaggtgcttacggcgggcaatcccgacgaacgccgcaatccggccagcctg
accaagttaatgacgggctatgtcgttgaccgcgccatcgatcaaaagaaaattacgcgc
gacgatatggtcaccgtggggaaagacgcctgggccgcaggcaatccggtctttaaaggt
tcatcgctcatgttcctgaaaccgggcgataagttgagcgtgcgcgacttaagccgcggt
gtcattatcgattcgggtaacgatgcctgcgtggcgctggccgattatgtcgcgggcagc
caggacaactttgtgaagttgatgaatcattacgtagagaaactgggcctgaccaatacc
catttcgaaaccgtccacggtctggatgcgccaggacagttctccagtgcgctggacatg
gcaaagctgtctcgcgccatcatcgacggcgagccggatttctatgccatgtaccgtgag
aaaaccctgacctggaatggcatcactcagaacaaccgcaatggtctgctgtgggataac
agtcttcacgtggatggtctgaaaacaggtcataccgaaaccgcaggatttaatatcatc
gcctcaaatgtggtcggtcagcatcgcctgattgccgtggtgatgggcggtaaaagcgcg
aaagggcgcgaagagcaggcgcgtaaactgctggtctggggccagaatacgttcgacacg
gtccaactgttccatgcgggcaagaagatcggcagcgaacacgtgtggtacggcaatccg
catcaggttgaggtgggcacggcaaatgatgtttacctgtcgctcccgcgcagtgaaatt
ccgaacgtgaaagccaaatacgtgattaaccgtagcgatctggaagcaccgctgaaagcc
aatgagaacattggtgagattcaggtcatggataaagacaagcagattgccagttatccg
ctggtggcgctcagtgccgttaacgaagccggcatgtttagccgcctctccgactatctg
aaacgtaagttttaa

DBGET integrated database retrieval system