KEGG   Pantoea ananatis AJ13355: PAJ_1751
Entry
PAJ_1751          CDS       T01969                                 

Gene name
sbcB
Definition
(GenBank) exodeoxyribonuclease I SbcB
  KO
K01141  exodeoxyribonuclease I [EC:3.1.11.1]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:paj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    PAJ_1751 (sbcB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:paj03400]
    PAJ_1751 (sbcB)
Enzymes [BR:paj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.1  exodeoxyribonuclease I
     PAJ_1751 (sbcB)
DNA repair and recombination proteins [BR:paj03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     PAJ_1751 (sbcB)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     PAJ_1751 (sbcB)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      PAJ_1751 (sbcB)
SSDB
Motif
Pfam: Exonuc_X-T_C RNase_T
Other DBs
NCBI-ProteinID: BAK11831
UniProt: A0A0H3KXQ5
Position
2116947..2118185
AA seq 412 aa
MITGITPQIAASRGVSEAEFAARIHALFTAEQTCVVGYNNVRFDDEVTRNIFYRNFYDPY
GWSWQNGNSRWDLLDVMRACYALRPEGINWPENEDGFPSFRLEHLTKANGVAHENAHDAM
SDVYATLAMAKLVKEKQPKLFEFLFTHRNKNKLMTLIDIPQMKPLVHVSGMFGAARGNTS
WVVPLAWHPDNRNALIVVDLAGDMTPLLTLDADSLRERLYTRKSELGDQSAIPVKLVHIN
KCPVLAPANTLRPEDAGRLGIDRKSCLDNLATLRQHPEIREKLVAIFADAEPFTPSDDVD
TQLYDGFFSDADRAGMNIIRQTAPANLPALDLTFDSPRVAKLLFRYRARNFPGTLDDAEQ
QRWLQHRREVLNPDKVQSFLMELESLASLHESDQEKLAQLKALYLYAQELVS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgattaccggtattacgccgcaaattgccgcctcgcggggcgtcagcgaggccgagttt
gccgcccgcattcatgccctgttcaccgccgaacaaacctgcgtggtgggctacaacaac
gtgcgcttcgacgatgaagtgacacgcaatattttctaccgcaacttctacgatccctat
ggctggagctggcaaaacggtaactctcgctgggatttgctggacgtgatgcgtgcctgc
tatgcgctgcggcccgaaggcatcaactggcccgaaaatgaagacggttttcccagcttc
cggctggagcacctgaccaaagccaacggcgtagcccatgaaaacgcccacgatgcgatg
tcggatgtctatgccacactcgccatggcgaaactggtgaaagagaaacagcctaagctg
ttcgagtttttgtttacgcatcgcaacaaaaacaaactcatgaccctgatcgatattcca
cagatgaagccgctggtgcacgtttccggcatgtttggcgcagcacgcggcaataccagt
tgggtggtgccgcttgcctggcatccggataaccgcaatgcgctaatcgtggtcgacctg
gccggggatatgacgccgcttttgacactggatgccgacagcctgcgcgaacgtctctac
acgcgcaaaagcgagttgggcgatcaatcagccattcccgttaagctggtgcacatcaat
aagtgccccgtgctggctccggcgaataccctgcggcctgaagatgccgggcggttgggc
atcgatcgcaagtcttgtctggataatctggcgacgctgcgtcagcatcctgaaatacgt
gaaaagctggtggcgatatttgccgatgcggaaccctttacgccgtcggatgatgtggat
acccagctctacgatggcttctttagcgatgccgatcgggcgggcatgaacattattcgc
cagacggcgccggctaacctgcccgcgctggatctgacgtttgacagtccgcgcgtggcg
aagctgctgtttcgttatcgggcgcggaacttccccggcaccctggatgatgctgaacaa
cagcgctggctgcagcaccgtcgcgaagtactgaatccggataaggtgcagtcgtttttg
atggagctggaatcgctggccagcctgcatgaaagcgatcaggaaaagctggcccagtta
aaagcgctgtatctgtatgcgcaggaactggtgtcctga

DBGET integrated database retrieval system